Ami.ac.uk
Domain Summary
What is the traffic rank for Ami.ac.uk?
• Ami.ac.uk ranks #1,366,073 globally on HypeStat.
What percent of global Internet users visit Ami.ac.uk?
• 0.00018% of global Internet users visit Ami.ac.uk
How many people visit Ami.ac.uk each day?
• Ami.ac.uk receives approximately 8.9K visitors and 10,649 page impressions per day.
Which countries does Ami.ac.uk receive most of its visitors from?
• Ami.ac.uk is mostly visited by people located in United States.
How much Ami.ac.uk can earn?
• Ami.ac.uk should earn about $45.55/day from advertising revenue.
What is Ami.ac.uk estimated value?
• Estimated value of Ami.ac.uk is $33,648.23.
Where are Ami.ac.uk servers located in?
• Ami.ac.uk has servers located in Scranton, PA, 18501, United States.
ami.ac.uk Profile
What technologies does ami.ac.uk use?
These are the technologies used at ami.ac.uk. ami.ac.uk has a total of 9 technologies installed in 7 different categories.ami.ac.uk Traffic Analysis
Ami.ac.uk is ranked #1,366,073 in the world. This website is viewed by an estimated 8.9K visitors daily, generating a total of 10.6K pageviews. This equates to about 268.9K monthly visitors.Daily Visitors8.9K
Monthly Visits268.9K
Pages per Visit1.20
Visit duration n/a
Bounce Rate n/a
Is this your site?Verify your site's metrics.
- Daily Unique Visitors:
- 8,874
- Monthly Visits:
- 268,882
- Pages per Visit:
- 1.20
- Daily Pageviews:
- 10,649
- Avg. visit duration:
- n/a
- Bounce rate:
- n/a
- Global Reach:
- 0.00018%
- HypeRank:
- 1,366,073
Visitors by country
- Country
- Users%
- United States 26.3%
Last update was 5320 days ago
This can take up to 60 seconds. Please wait...
This can take up to 60 seconds. Please wait...
*HypeStat.com is not promoting or affiliated with ami.ac.uk in any way. Only publicly available statistics data are displayed.
▼
SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.- Domain:
- ami.ac.uk
- Rank:
(Rank based on keywords, cost and organic traffic) - n/a
- Organic Keywords:
(Number of keywords in top 20 Google SERP) - 0
- Organic Traffic:
(Number of visitors coming from top 20 search results) - 0
- Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords) - $0.00
Revenue report ▼
Google.com would generate approximately $45.6 per day if the source of income were advertisements, which equates to an estimated monthly revenue of $1.4K and annual gross revenue of approximately $16.6K. Based on these figures, the site's net worth is estimated at around $33.6K.How much would ami.ac.uk make?
- Daily Revenue:
- $45.55
- Monthly Revenue:
- $1,366.50
- Yearly Revenue:
- $16,625.75
Daily earning by country
- CountryPageviewsEarning
- United States 2,769$13.37
Loss of money due to Adblock?
- Daily Revenue Loss:
- $2.41
- Monthly Revenue Loss:
- $72.21
- Yearly Revenue Loss:
- $878.61
- Daily Pageviews Blocked:
- 498
- Monthly Pageviews Blocked:
- 14,951
- Yearly Pageviews Blocked:
- 181,906
Daily revenue loss by country
- CountryBlockedLost Money
- United States 498$2.41
How much is ami.ac.uk worth?
- Website Value:
- $33.6K
Ad Experience Report ▼
Summary of the ad experience rating of a website for a specific platform.Mobile summary
- Root domain:
- ami.ac.uk
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Desktop summary
- Root domain:
- ami.ac.uk
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Abusive Experience Report ▼
Summary of the abusive experience rating of a website.- Root domain:
- ami.ac.uk
- Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.) - Off
- Status:
(The status of the site reviewed for the abusive experiences.) - Not reviewed
Where is ami.ac.uk hosted? ▼
Ami.ac.uk may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.- Server IP:
- n/a
- ASN:
- AS21788
- ISP:
- Network Operations Center Inc.
- Server Location:
- Scranton
PA
18501
United States
Other sites hosted on n/a
There are no other sites hosted on this IPDoes ami.ac.uk use compression? ▼
Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on ami.ac.uk are reduced by %.
ami.ac.uk does not use compression.
Original size: n/a
Compressed size: n/a
File reduced by: (%)
Compressed size: n/a
File reduced by: (%)
Google Safe Browsing ▼
Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.SSL Checker - SSL Certificate Verify ▼
An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. ami.ac.uk does not support HTTPS. ami.ac.uk does not support HTTPS
Verifying SSL Support. Please wait...
Verify HTTP/2 Support ▼
HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency. ami.ac.uk does not support HTTP/2
Verifying HTTP/2.0 Support. Please wait...
Http Header ▼
HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.HTTP/1.1 200 OK
Date: Thu, 26 May 2011 13:58:04 GMT
Server: Apache/1.3.12 (Unix) Sun-ONE-ASP/4.0.0 PHP/4.4.7 ApacheJserv/1.1.2
pragma: no-cache
Connection: Keep-Alive, close
Cache-control: private
Expires: Thu, 26-May-2011 13:58:04 GMT
Set-Cookie: ASPSESSIONIDGGGGGGGG=GZQEWDMMEFYVRLCDQNWMYSQQHQQQHHIL; path=/
Content-Length: 9787
Content-Type: text/html
DNS Lookup ▼
DNS entries (Domain Name System) are a critical component of the Internet infrastructure. They act as directories that translate human-readable domain names (such as example.com) to machine-readable IP addresses. DNS records are stored on DNS servers and help forward internet traffic efficiently.| Type | Ip | Target/Txt | TTL |
| MX | 86400 | ||
| MX | 86400 | ||
| SOA | 86400 | ||
| Mname | sleepy.acs.bolton.ac.uk | ||
| Rname | hostmaster.bolton.ac.uk.ami.ac.uk | ||
| Serial Number | 20031028 | ||
| Refresh | 28800 | ||
| Retry | 7200 | ||
| Expire | 604800 | ||
| Minimum TTL | 86400 | ||
| NS | 86400 | ||
| NS | 86400 |