Alwaysfirstdrivingacademyonline.com
Domain Summary
What is the traffic rank for Alwaysfirstdrivingacademyonline.com?
• Alwaysfirstdrivingacademyonline.com ranks #8,171,370 globally on HypeStat.
What IP addresses does Alwaysfirstdrivingacademyonline.com resolve to?
• Alwaysfirstdrivingacademyonline.com resolves to the IP addresses 44.209.199.119.
Where are Alwaysfirstdrivingacademyonline.com servers located in?
• Alwaysfirstdrivingacademyonline.com has servers located in Ashburn, Virginia, 20149, United States.
alwaysfirstdrivingacademyonline.com Profile

What technologies does alwaysfirstdrivingacademyonline.com use?
These are the technologies used at alwaysfirstdrivingacademyonline.com. alwaysfirstdrivingacademyonline.com has a total of 3 technologies installed in 4 different categories.alwaysfirstdrivingacademyonline.com Traffic Analysis
Alwaysfirstdrivingacademyonline.com is ranked #8,171,370 in the world.Daily Visitors n/a
Monthly Visits n/a
Pages per Visit n/a
Visit duration n/a
Bounce Rate n/a
Is this your site?Verify your site's metrics.
- Daily Unique Visitors:
- n/a
- Monthly Visits:
- n/a
- Pages per Visit:
- n/a
- Daily Pageviews:
- n/a
- Avg. visit duration:
- n/a
- Bounce rate:
- n/a
- Global Reach:
- n/a
- HypeRank:
- 8,171,370
Backlinks Report ▼
Alwaysfirstdrivingacademyonline.com has a total of 45 backlinks from 37 referring domains and most of them comes from United States.- Total Backlinks:
- 45
- Follow Links:
- n/a
- Nofollow Links:
- n/a
- Referring Domains:
- 37
- Referring IPs:
- 2
- Authority Domain Score:
- 0
Backlinks by country
- Country
- Domains
- United States 37
Backlinks by TLDs
- TLD Distribution
- Domains
- .pw
- 28
- .com
- 5
- .net
- 3
- .edu
- 0
- .gov
- 0
Last update was 786 days ago
This can take up to 60 seconds. Please wait...
This can take up to 60 seconds. Please wait...
*HypeStat.com is not promoting or affiliated with alwaysfirstdrivingacademyonline.com in any way. Only publicly available statistics data are displayed.
▼
SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.- Domain:
- alwaysfirstdrivingacademyonline.com
- Rank:
(Rank based on keywords, cost and organic traffic) - n/a
- Organic Keywords:
(Number of keywords in top 20 Google SERP) - 0
- Organic Traffic:
(Number of visitors coming from top 20 search results) - 0
- Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords) - $0.00
Ad Experience Report ▼
Summary of the ad experience rating of a website for a specific platform.Mobile summary
- Root domain:
- alwaysfirstdrivingacademyonline.com
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Desktop summary
- Root domain:
- alwaysfirstdrivingacademyonline.com
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Abusive Experience Report ▼
Summary of the abusive experience rating of a website.- Root domain:
- alwaysfirstdrivingacademyonline.com
- Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.) - Off
- Status:
(The status of the site reviewed for the abusive experiences.) - Not reviewed
Where is alwaysfirstdrivingacademyonline.com hosted? ▼
Alwaysfirstdrivingacademyonline.com may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.- Server IP:
- 44.209.199.119
- ASN:
- AS14618
- ISP:
- Amazon.com, Inc.
- Server Location:
- Ashburn
Virginia, VA
20149
United States, US
Other sites hosted on 44.209.199.119
Does alwaysfirstdrivingacademyonline.com use compression? ▼
Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on alwaysfirstdrivingacademyonline.com are reduced by %.
alwaysfirstdrivingacademyonline.com does not use compression.
Original size: n/a
Compressed size: n/a
File reduced by: (%)
Compressed size: n/a
File reduced by: (%)
Google Safe Browsing ▼
Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.SSL Checker - SSL Certificate Verify ▼
An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. alwaysfirstdrivingacademyonline.com does not support HTTPS. alwaysfirstdrivingacademyonline.com does not support HTTPS
Verifying SSL Support. Please wait...
Verify HTTP/2 Support ▼
HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency. alwaysfirstdrivingacademyonline.com does not support HTTP/2
Verifying HTTP/2.0 Support. Please wait...
DNS Lookup ▼
DNS entries (Domain Name System) are a critical component of the Internet infrastructure. They act as directories that translate human-readable domain names (such as example.com) to machine-readable IP addresses. DNS records are stored on DNS servers and help forward internet traffic efficiently.Type | Ip | Target/Txt | TTL |
SOA | 820 | ||
Mname | ns-487.awsdns-60.com | ||
Rname | awsdns-hostmaster.amazon.com | ||
Serial Number | 1 | ||
Refresh | 7200 | ||
Retry | 900 | ||
Expire | 1209600 | ||
Minimum TTL | 86400 | ||
NS | 3502 | ||
NS | 3502 | ||
NS | 3502 | ||
NS | 3502 |
Whois Lookup ▼
Domain WHOIS is a public database that provides information about domain names, including registered owners, contact information, domain registrars, registration and expiration dates, name servers, and other relevant information. Domain registration for this website began on January 30, 2023 and will expire on January 30, 2024 if not renewed. This website is now assigned through the registrar Amazon Registrar, Inc.. The WHOIS data for this website's domain was last updated on May 2, 2023.- Domain Created:
- 2023-01-30
- Domain Expires:
- 2024-01-30
- Domain Updated:
- 2023-05-02
- Domain Age:
- 2 years 6 months
- Domain Registrar:
- Amazon Registrar, Inc.
- Domain Owner:
- Identity Protection Service
- WhoIs:
Domain Name: alwaysfirstdrivingacademyonline.com Registry Domain ID: 2754875499_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.registrar.amazon.com Registrar URL: https://registrar.amazon.com Updated Date: 2023-05-03T00:29:05Z Creation Date: 2023-01-30T18:02:00Z Registrar Registration Expiration Date: 2024-01-30T18:02:00Z Registrar: Amazon Registrar, Inc. Registrar IANA ID: 468 Registrar Abuse Contact Email:Registrar Abuse Contact Phone: +1.2067406200 Domain Status: ok https://icann.org/epp#ok Registry Registrant ID: Not Available From Registry Registrant Name: On behalf of alwaysfirstdrivingacademyonline.com owner Registrant Organization: Identity Protection Service Registrant Street: PO Box 786 Registrant City: Hayes Registrant State/Province: Middlesex Registrant Postal Code: UB3 9TR Registrant Country: GB Registrant Phone: +44.1483307527 Registrant Phone Ext: Registrant Fax: +44.1483304031 Registrant Fax Ext: Registrant Email:
Registry Admin ID: Not Available From Registry Admin Name: On behalf of alwaysfirstdrivingacademyonline.com owner Admin Organization: Identity Protection Service Admin Street: PO Box 786 Admin City: Hayes Admin State/Province: Middlesex Admin Postal Code: UB3 9TR Admin Country: GB Admin Phone: +44.1483307527 Admin Phone Ext: Admin Fax: +44.1483304031 Admin Fax Ext: Admin Email:
Registry Tech ID: Not Available From Registry Tech Name: On behalf of alwaysfirstdrivingacademyonline.com owner Tech Organization: Identity Protection Service Tech Street: PO Box 786 Tech City: Hayes Tech State/Province: Middlesex Tech Postal Code: UB3 9TR Tech Country: GB Tech Phone: +44.1483307527 Tech Phone Ext: Tech Fax: +44.1483304031 Tech Fax Ext: Tech Email:
Name Server: NS-487.AWSDNS-60.COM Name Server: NS-650.AWSDNS-17.NET Name Server: NS-1493.AWSDNS-58.ORG Name Server: NS-1567.AWSDNS-03.CO.UK DNSSEC: unsigned URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/ >>> Last update of WHOIS database: 2023-06-04T17:05:07Z