IBEE Software Solutions Pvt. Ltd.

0.0015% of sites are hosted by IBEE Software Solutions Pvt. Ltd.

Autonomous System Number

AS58909

Top Domains Hosted at IBEE Software Solutions Pvt. Ltd.

Bounce ratePages / VisitVisit duration
51schemecolor.com
Color Schemes and Color Combinations - Schemecolor.com
The quick, simple and easiest way to browse color schemes - Schemecolor.com
n/a 1.60 n/a
52formzero.in
Home Page | FormZero
Home Page | FormZero
n/a 2.70 n/a
53kansaz.in
Kansas - Immigration and Visa Consultants Australia,Canada,Denmark and Hong Kong
Kansas Overseas Careers is the visa immigration consultants in India. Providing immigration services and visa processing for Canada, Denmark, Australia and Hongkong
n/a 2.80 n/a
54srisubrahmanyaswamydevalayamskandagiri.org
.:: SRI SUBRAHMANYASWAMY DEVALAYAM SKANDAGIRI ::.
n/a 7.00 n/a
55beaustralian.com
Opulentus - Australia Immigration, Visa Consultants, PR
Immigration to Australia is very simple for Indians. With the guidance from Opulentus, the best Visa Consultants, migrate to and work in Australia.
n/a 5.90 n/a
56hireejobs.com
Hiree Jobs - Job Search - Latest Job Openings - Job Vacancies
Connect With latest job openings online including IT, Sales, Banking, Marketing, Fresher, Walk-ins, Part time,etc. Search and Apply for Latest Job Vacancies across Top Companies in India. Post your CV Now !.
n/a 3.30 n/a
57angrau.ac.in
:: ACHARYA N G RANGA AGRICULTURAL UNIVERSITY ::
:: ACHARYA N G RANGA AGRICULTURAL UNIVERSITY ::
n/a 2.50 n/a
581stolica.com.ua
Культурно-исторический видеоканал. Материалы по истории города, текстовый архив сюжетов.
n/a 3.90 n/a
59zentora.com
MigrationIdeas offer immigration consultancy services in Hyderabad, Bangalore, and Mumbai. We processes student, work, PR Visas for Australia, Canada, Denmark and so on.
n/a 5.90 n/a
60meanjsonline.com
MeanJS Training Institute in Ameerpet Hyderabad - MeanJS Online
MeanJS Training Institute Provides Training in NodeJS, MongoDB, AngularJS, Angular4, Ionic Framework in Hyderabad, Bangalore, Mumbai, Chennai, Delhi, Pune
n/a 7.80 n/a
61aayushcorporatestays.com
n/a 1.80 n/a
62fontmagic.com
FontMagic - Quickly download free fonts with simple graphics
The Easiest way to download fonts for free with awesome graphic samples, Lets quickly browse all fonts by today's categories - FontMagic
20.00 1.90 08:46
63ranksiliconerp.com
n/a 16.00 n/a
64zawata.in
n/a 4.80 n/a
65immigrationadvisors.com
Find the Best Immigration Advisors
ImmigrationAdvisors helps the People who are interested to migrate to Abroad to find there best Advisors.
n/a 10.00 n/a
66masterbuilder.co.in
Construction magazine | Construction news | Builders magazine | Building Construction Magazine | Masterbuilder
Construction magazine | Construction news | Builders magazine | Building Construction Magazine | Masterbuilder
n/a 2.10 n/a
67pjtsau.ac.in
Professor Jayashankar Telangana State Agricultural University
n/a 3.40 n/a
68visaproblems.com
Visa Problems Is The Unique Stage To Discuss Your Visa Related Queries.
Aspirants can understand immigration Procedures of work visas, Students visas, investor visa programs & Dependents visas and share their immigration
n/a 8.20 n/a
69shoppirate.in
Shop *** – Get Coupons, promo codes and Discounts
Save money and time by getting discounts using coupons, coupon codes and promo codes from several online stores in India. Get coupon notifications delivered to your emails and mobiles.
27.57 1.20 01:22
70busoffers.com
Online bus boking offers | Online Bus Ticket bookings across India
n/a 2.10 n/a
71dmtimumbai.com
DMTI Member's Area
n/a 4.60 n/a
72gterp.co
Globaltree - Education and Immigration Consultants India
n/a 6.10 n/a
73shinejobs.net
Shine Jobs | Shinejobs | Latest Government Job Notifications
Find the Best jobs in shine jobs.net , shinejobs India’s No. 1 Job Site. Search for Job Vacancies across Top Companies in India. Post your Resume now to find
n/a 11.00 n/a
74immigrationnews.com
Immigration News - Latest Immigration News Updates, Visa Updates
Immigrationnews.com provides the all latest immigration news updates, and visa news updates.
n/a 5.60 n/a
75lotmobiles.com
Lot Mobiles - Smart Mobiles Shop in India | Smart Phones | Tablets | Online Mobile Shopping
Lot Mobiles
n/a 4.20 n/a
76globaltree.co.in
Globaltree - Immigration Consultants India | Visa Consultants
Globaltree - Immigration Consultants India - A leading immigration and visa consultants that provides visa processing services for Australia, Canada, Denmark, Hong Kong, USA, UK.with branches
n/a 4.30 n/a
77naticket.com
n/a 18.00 n/a
78canada-jobs.com
canada-jobs.com – For all Canada Jobs
n/a 4.30 n/a
79anyrequirement.com
::Anyrequirement.com::India's most innovative B2B website
::Anyrequirement.com::India's most innovative B2B website
n/a 4.00 n/a
80titki.org
Титьки. орг - голые знаменитости, русские и иностранные звезды фото и видео
Видео и фото обнаженных знаменитостей, съемки для журналов, кадры из фильмов, фотографии папараци
n/a 3.20 n/a
81cobold.xyz
cobold digital
n/a 22.00 n/a
82firstbel.com
Anaganagaa...!
n/a 3.00 n/a
83srisailamonline.com
Srisailam Bhramarambha Mallikharjuna Swami Devasthanam
Srisailam Bhramarambha Mallikharjuna Swami Devasthanam
n/a 4.10 n/a
84interiorsinsider.com
Interiors Insider | Ideas for your Home & Office Interiors | We Love Interiors
Welcome to the home of Interior Insider. Find expert advice on every aspect of good design – be it Product, Vendors, interior companies, Designers, etc
n/a 7.10 n/a
85malaysianvisas.com
Opulentus - Malaysian Immigration & Visa Process Consultants
Planning to migrate to Malaysia? Get in touch with Opulentus – Best Immigration and Visa consultants. Apply for your visa; get information on visa requirements and documentation services from Opulentus.
n/a 2.30 n/a
86opulentus.net
Opulentus-right destination for visa needs
Opulentus-the Visa Company, has started functioning since 2001. At a point of time when immigration word sounded Greek and Latin to scores,
n/a 4.00 n/a
87embica.com
Embica: Mobile Discount Coupons - July, 2015 on Flipkart, Amazon, Snapdeal in India
Embica helps to online shopping buyers make save money with mobile discount Coupons & Deals - 2015 in India @ Flipakrt, Amazon, Snapdeal, Infibeam & Shopclues. Shop Now with Embica Website & Mobile APP
n/a 3.30 n/a
88textmysms.in
Text My SMS - Best WhatsApp Bulk SMS service provider in India, Cheapest WhatsApp Bulksms company, Online Bulk SMS Gateway, Bulk Whatsapp Marketing
Best WhatsApp Bulk sms service provider in India. Textmy Bulksms company in Indias No.1 Bulk sms provider offers Online Bulk Sms Marking using Promotional & Transactional WhatsApp SMS services. We Also offers Online Bulksms Gateway with web api service which allows you to integrate sms in yoru website or software.
n/a 1.00 n/a
89opulentuz.in
Opulentus - Expert Visa Advisors
Opulentus is a leading visa consultancy that has been offering world-class visa services for over a decade.
n/a 4.60 n/a
90charaka.org
Ayurveda | CHARAKA ~ The Speciality Ayurveda | Best Ayurvedic Hospital | Best Ayurvedic Doctor | Best Ayurveda Panchakarma Therapy Center | Hyderabad | Secunderabad | India | Telangana | Kerala Ayurveda | Famous Ayurvedic Hospital | Ayurveda India | Ayurveda Hyderabad | Best Panchakarma | Kerala Panchakarma | Dr M Chandrashekhar | Ayurvedic Medicines | No 1 Ayurvedic Hopsital
Renowned traditional & speciality Ayurveda Panchakarma centre providing best & genuine therapies for treating Motor Neurone Disease (MND), Multiple Sclerosis (MS), Parkinson's disease, Ankylosing spondylitis, Rheumatoid arthritis, Slip disc, Sciatica, Cervical & Lumbar Spondylitis, Paralysis, Cerebral Palsy, Mental retardation, Osteo arthritis, Gout, ,Degenerative disorderds, Neuro-muscular disorders, Psychosomatic diseases (Psoriasis, IBS), Skin diseases, *** disorders, Infertility, Obesity, Allergy, Asthma, Diabetic complications etc.'CHARAKA-THE SPECIALITY AYURVEDA' Institute of Panchakarma & Research, a traditional health care & Panchakarma therapy center, came into existence in...
n/a 2.00 n/a
91hyderabadgiftsdelivery.com
Hyderabad & Secunderabad Gifts Delivery Online | online gifts delivery in hyderabad | Send Gifts to Hyderabad | Hyderabad gifts delivery same day | Midnight gifts delivery in Hyderabad
hyderabad gifts online, hyderabad gifts delivery, gifts delivery on sameday, hyderabad gifts same day delivery, hyderabad gifts online shopping, gifts for wedding, gifts for birthday, anniversary online, hyderabad gifts flowers, cakes, chocolates, sweets, dry fruits, fresh fruit hampers, teddy bears, hyderabad gifts in India, gifts to hyderabad from usa, uk send gifts to hyderabad online, Hyderabad online gifts for delivery, hyderabad online shopping for the delivery of gifts, midnight gifts delivery in hyderabad, midnight gifts online in hyderabad
n/a 3.00 n/a
92usavisastore.com
Opulentus - USA Immigration & Visa Process Consultants
Migrate to USA, Apply for USA immigration visas from Opulentus - the best USA immigration & visa process consultants. Opulentus provides services for USA Work visas, Student Visas, Visit Visas, Business Visas. For eligibility & visa requirements contact Opulentus.
n/a 3.70 n/a
93i2space.in
Domain Default page
n/a 8.00 n/a
94visabook.com
VisaBook - Social Network Platform for Visa Aspirants
n/a 11.00 n/a
95visualpath.in
Best Software Training Institute in Hyderabad | Online Training institute
Visual Path Training institute is one of the best leading Software training institute in Hyderabad,India. Offers Online, Classroom and Corporate training.
n/a 2.70 n/a
96ramanclasses.org
Raman Classes
n/a 3.00 n/a
97golfgaga.com
Golfgaga – Where golfers meet! | Golf in India | Top golf courses in India
Golfgaga – Where golfers meet! | Golf in India | Top golf courses in India
n/a 2.20 n/a
98winvision.in
.:: Best Eye Hospital in Hyderabad, Eye specialists in Hyderabad ::.
win vision is one of the best eye hospitals in hyderabad with best eye surgeons providing best lasik surgery, cataract surgery in hyderabad with mastered pediatric ophthalmologist and squint specialist in hyderabad.
n/a 9.00 n/a
99visas2hk.com
Opulentus - Hong Kong Migration, Immigration, Visa Consultants, QMAS
Opulentus provide complete guidance on all aspects of Immigration, Migration to Hong Kong which range from various visa options to settle in Hong Kong.
n/a 3.90 n/a
100visas2germany.com
Opulentus - Germany Immigration & Visa Process Consultants
Migrate to Germany with Opulentus - Best Immigration and Visa Service consultants In India, UK, USA, Canada, Australia & Ireland. Apply for visa from Opulentus to have a safe and hassle free immigration to Germany. For information on Germany visa requirements and documentation services contact Opulentus.
n/a 3.60 n/a
<< < 1 2 3 4 5 6 7 8 > >>