wellnessselfservicedispensary.com Wellnessselfservicedispensary.com

   

Domain Summary

What is the traffic rank for Wellnessselfservicedispensary.com?

• Wellnessselfservicedispensary.com ranks #14,432,830 globally on HypeStat.

What IP addresses does Wellnessselfservicedispensary.com resolve to?

• Wellnessselfservicedispensary.com resolves to the IP addresses 50.63.202.54.

Where are Wellnessselfservicedispensary.com servers located in?

• Wellnessselfservicedispensary.com has servers located in Scottsdale, Arizona, 85260, United States.

wellnessselfservicedispensary.com Profile

What technologies does wellnessselfservicedispensary.com use?

These are the technologies used at wellnessselfservicedispensary.com. wellnessselfservicedispensary.com has a total of 3 technologies installed in 3 different categories.

wellnessselfservicedispensary.com Traffic Analysis

Wellnessselfservicedispensary.com is ranked #14,432,830 in the world.
Daily Visitors n/a
Monthly Visits n/a
Pages per Visit n/a
Visit duration n/a
Bounce Rate n/a
Is this your site?Verify your site's metrics.
Daily Unique Visitors:
 n/a
Monthly Visits:
n/a
Pages per Visit:
n/a
Daily Pageviews:
n/a
Avg. visit duration:
n/a
Bounce rate:
n/a
Global Reach:
 n/a
HypeRank:
14,432,830
*All traffic values are estimates only.
Last update was 2253 days ago
     
This can take up to 60 seconds. Please wait...

*HypeStat.com is not promoting or affiliated with wellnessselfservicedispensary.com in any way. Only publicly available statistics data are displayed.

 

SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.
SemRushSemRush
Domain:
  wellnessselfservicedispensary.com
Rank:
(Rank based on keywords, cost and organic traffic)
  n/a
Organic Keywords:
(Number of keywords in top 20 Google SERP)
  0
Organic Traffic:
(Number of visitors coming from top 20 search results)
  0
Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords)
  $0.00

Ad Experience Report

Summary of the ad experience rating of a website for a specific platform.

Mobile summary

Root domain:
wellnessselfservicedispensary.com
Ad filtering:
(Chrome is not filtering ads on your site.)
Off
Status:
(The status of the site that is reviewed for the Better Ads Standards.)
Not reviewed

Desktop summary

Root domain:
wellnessselfservicedispensary.com
Ad filtering:
(Chrome is not filtering ads on your site.)
Off
Status:
(The status of the site that is reviewed for the Better Ads Standards.)
Not reviewed

Abusive Experience Report

Summary of the abusive experience rating of a website.
Root domain:
wellnessselfservicedispensary.com
Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.)
Off
Status:
(The status of the site reviewed for the abusive experiences.)
Not reviewed

Where is wellnessselfservicedispensary.com hosted?

Wellnessselfservicedispensary.com may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.
Server IP:
50.63.202.54
ASN:
AS26496 
ISP:
GoDaddy.com, LLC 
Server Location:
Scottsdale
Arizona, AZ
85260
United States, US
 

Other sites hosted on 50.63.202.54

Does wellnessselfservicedispensary.com use compression?

Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on wellnessselfservicedispensary.com are reduced by 4%.
wellnessselfservicedispensary.com use gzip compression.
Original size: 509 B
Compressed size: 486 B
File reduced by: 23 B (4%)

Google Safe Browsing

Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.
This site is not currently listed as suspicious

SSL Checker - SSL Certificate Verify

An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. wellnessselfservicedispensary.com does not support HTTPS.
 wellnessselfservicedispensary.com does not support HTTPS
     
Verifying SSL Support. Please wait...

Verify HTTP/2 Support

HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency.
 wellnessselfservicedispensary.com does not support HTTP/2
     
Verifying HTTP/2.0 Support. Please wait...

Http Header

HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.
Content-Length: 1032
Content-Type: text/html
Content-Location: http://beautifulaltamont.com/Default.htm
Last-Modified: Thu, 06 Jun 2019 19:06:05 GMT
Accept-Ranges: bytes
ETag: "2ed9fee39a1cd51:5897"
Server: Microsoft-IIS/6.0
X-Powered-By: ASP.NET
Date: Thu, 05 Sep 2019 22:03:42 GMT
Content-Type: text/html
Server: Microsoft-IIS/7.5
X-Powered-By: ASP.NET
Date: Thu, 05 Sep 2019 22:05:42 GMT
Content-Length: 1157
Content-Type: text/html; charset=iso-8859-1
Content-Length: 237
Connection: keep-alive
Keep-Alive: timeout=15
Date: Thu, 05 Sep 2019 22:04:06 GMT
Server: Apache
Location: https://mypremiumcontent.com/

HTTP/2 200 
content-type: text/html; charset=UTF-8
date: Thu, 05 Sep 2019 22:04:07 GMT
server: Apache
x-powered-by: PHP/7.3.8
content-encoding: gzip
Date: Thu, 05 Sep 2019 22:04:08 GMT
Content-Type: text/html
Transfer-Encoding: chunked
Connection: keep-alive
Set-Cookie: __cfduid=d17aa2b15cf33124fee1f41ac7ea2a5651567721048; expires=Fri, 04-Sep-20 22:04:08 GMT; path=/; domain=.lnswf.com; HttpOnly
Location: http://www.lnswf.com/
Server: cloudflare
CF-RAY: 511b7f4b5ef94211-MSP

HTTP/1.1 200 OK
Date: Thu, 05 Sep 2019 22:04:09 GMT
Content-Type: text/html
Transfer-Encoding: chunked
Connection: keep-alive
Set-Cookie: __cfduid=d727a7ef22b2938ecbc5feb27367227f71567721049; expires=Fri, 04-Sep-20 22:04:09 GMT; path=/; domain=.lnswf.com; HttpOnly
X-Powered-By: ASP.NET
Server: cloudflare
CF-RAY: 511b7f4dd9d8c627-MSP
Content-Encoding: gzip
Server: nginx
Date: Thu, 05 Sep 2019 22:04:32 GMT
Content-Type: text/html; charset=utf-8
Content-Length: 51
Connection: keep-alive
Location: http://www.trekingnepal.com/
X-Served-By: Namecheap URL Forward

HTTP/1.1 200 OK
Server: nginx
Date: Thu, 05 Sep 2019 22:04:33 GMT
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Connection: keep-alive
Keep-Alive: timeout=15
Cache-Control: no-cache
Pragma: no-cache
Expires: -1
X-CST: MISS
X-CST: MISS
Allow: GET, HEAD
Connection: close
Pragma: no-cache
cache-control: no-cache
Location: /YSVXe/

HTTP/1.1 302 Found
Connection: close
Pragma: no-cache
cache-control: no-cache
Location: /

HTTP/1.1 200 OK
Cache-Control: no-cache
Pragma: no-cache
Content-Type: text/html; charset=utf-8
Content-Encoding: gzip
Expires: -1
Vary: Accept-Encoding
Server: Microsoft-IIS/7.5
X-AspNet-Version: 4.0.30319
X-Powered-By: ASP.NET
Date: Thu, 05 Sep 2019 22:04:33 GMT
Content-Length: 455
Age: 1
Connection: keep-alive
Date: Thu, 05 Sep 2019 22:04:36 GMT
Server: Apache
Location: https://ewawiese.com/
Content-Length: 229
Content-Type: text/html; charset=iso-8859-1

HTTP/2 200 
date: Thu, 05 Sep 2019 22:04:37 GMT
server: Apache
link: <https://ewawiese.com/wp-json/>; rel="https://api.w.org/", <https://ewawiese.com/>; rel=shortlink
vary: Accept-Encoding,User-Agent
content-encoding: br
content-type: text/html; charset=UTF-8
Date: Thu, 05 Sep 2019 22:04:44 GMT
Server: Apache/2.2.15 (CentOS)
Connection: close
Transfer-Encoding: chunked
Content-Type: text/html; charset=iso-8859-1
Connection: close
Pragma: no-cache
cache-control: no-cache
Location: /lYTOf/

HTTP/1.1 302 Found
Connection: close
Pragma: no-cache
cache-control: no-cache
Location: /

HTTP/1.1 200 OK
Cache-Control: no-cache
Pragma: no-cache
Content-Type: text/html; charset=utf-8
Content-Encoding: gzip
Expires: -1
Vary: Accept-Encoding
Server: Microsoft-IIS/7.5
X-AspNet-Version: 4.0.30319
X-Powered-By: ASP.NET
Date: Thu, 05 Sep 2019 22:04:45 GMT
Content-Length: 466
Age: 1
Connection: keep-alive
Date: Thu, 05 Sep 2019 22:04:53 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Vary: Accept-Encoding
Set-Cookie: .s=d43e47827d0d4002982a21412e135644; domain=.www.namecheap.com; path=/; samesite=lax; httponly
Set-Cookie: x-ncpl-csrf=fff559a7735448c9a2887f577d37b671; domain=.www.namecheap.com; path=/; samesite=lax
X-Proxy-Cache: HIT
Server: namecheap-nginx
Content-Encoding: gzip
Connection: close
Pragma: no-cache
cache-control: no-cache
Location: /MdpML/

HTTP/1.1 302 Found
Connection: close
Pragma: no-cache
cache-control: no-cache
Location: /

HTTP/1.1 200 OK
Cache-Control: no-cache
Pragma: no-cache
Content-Type: text/html; charset=utf-8
Content-Encoding: gzip
Expires: -1
Vary: Accept-Encoding
Server: Microsoft-IIS/7.5
X-AspNet-Version: 4.0.30319
X-Powered-By: ASP.NET
Date: Thu, 05 Sep 2019 22:04:53 GMT
Content-Length: 486
Age: 0
Connection: keep-alive

DNS Lookup

DNS entries (Domain Name System) are a critical component of the Internet infrastructure. They act as directories that translate human-readable domain names (such as example.com) to machine-readable IP addresses. DNS records are stored on DNS servers and help forward internet traffic efficiently.
Type Ip Target/Txt TTL
SOA 3600
Mname ns73.domaincontrol.com
Rname dns.jomax.net
Serial Number 2019060600
Refresh 28800
Retry 7200
Expire 604800
Minimum TTL 600
A 50.63.202.54 600
NS ns74.domaincontrol.com 3600
NS ns73.domaincontrol.com 3600