Shreeradhakrishanparivarsewasamiti.com
Domain Summary
What IP addresses does Shreeradhakrishanparivarsewasamiti.com resolve to?
• Shreeradhakrishanparivarsewasamiti.com resolves to the IP addresses 50.63.202.53.
Where are Shreeradhakrishanparivarsewasamiti.com servers located in?
• Shreeradhakrishanparivarsewasamiti.com has servers located in Scottsdale, Arizona, 85260, United States.
shreeradhakrishanparivarsewasamiti.com Profile
What technologies does shreeradhakrishanparivarsewasamiti.com use?
These are the technologies used at shreeradhakrishanparivarsewasamiti.com. shreeradhakrishanparivarsewasamiti.com has a total of 3 technologies installed in 3 different categories.shreeradhakrishanparivarsewasamiti.com Traffic Analysis
There's no enough data about shreeradhakrishanparivarsewasamiti.com traffic.Daily Visitors n/a
Monthly Visits n/a
Pages per Visit n/a
Visit duration n/a
Bounce Rate n/a
Is this your site?Verify your site's metrics.
- Daily Unique Visitors:
- n/a
- Monthly Visits:
- n/a
- Pages per Visit:
- n/a
- Daily Pageviews:
- n/a
- Avg. visit duration:
- n/a
- Bounce rate:
- n/a
- Global Reach:
- n/a
- HypeRank:
- n/a
Last update was 1642 days ago
This can take up to 60 seconds. Please wait...
This can take up to 60 seconds. Please wait...
*HypeStat.com is not promoting or affiliated with shreeradhakrishanparivarsewasamiti.com in any way. Only publicly available statistics data are displayed.
▼
SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.- Domain:
- shreeradhakrishanparivarsewasamiti.com
- Rank:
(Rank based on keywords, cost and organic traffic) - n/a
- Organic Keywords:
(Number of keywords in top 20 Google SERP) - 0
- Organic Traffic:
(Number of visitors coming from top 20 search results) - 0
- Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords) - $0.00
Ad Experience Report ▼
Summary of the ad experience rating of a website for a specific platform.Mobile summary
- Root domain:
- shreeradhakrishanparivarsewasamiti.com
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Desktop summary
- Root domain:
- shreeradhakrishanparivarsewasamiti.com
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Abusive Experience Report ▼
Summary of the abusive experience rating of a website.- Root domain:
- shreeradhakrishanparivarsewasamiti.com
- Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.) - Off
- Status:
(The status of the site reviewed for the abusive experiences.) - Not reviewed
Where is shreeradhakrishanparivarsewasamiti.com hosted? ▼
Shreeradhakrishanparivarsewasamiti.com may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.- Server IP:
- 50.63.202.53
- ASN:
- AS26496
- ISP:
- GoDaddy.com, LLC
- Server Location:
- Scottsdale
Arizona, AZ
85260
United States, US
Other sites hosted on 50.63.202.53
There are no other sites hosted on this IPDoes shreeradhakrishanparivarsewasamiti.com use compression? ▼
Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience.
shreeradhakrishanparivarsewasamiti.com use gzip compression.
Original size: 509 B
Compressed size: 509 B
File reduced by: n/a
Compressed size: 509 B
File reduced by: n/a
Google Safe Browsing ▼
Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.SSL Checker - SSL Certificate Verify ▼
An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. shreeradhakrishanparivarsewasamiti.com does not support HTTPS. shreeradhakrishanparivarsewasamiti.com does not support HTTPS
Verifying SSL Support. Please wait...
Verify HTTP/2 Support ▼
HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency. shreeradhakrishanparivarsewasamiti.com does not support HTTP/2
Verifying HTTP/2.0 Support. Please wait...
Http Header ▼
HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.Date: Sat, 04 Jan 2020 15:46:02 GMT
Content-Type: text/html
Transfer-Encoding: chunked
Connection: keep-alive
Set-Cookie: __cfduid=ded717587932a82ee405cb8a749fc80571578152762; expires=Mon, 03-Feb-20 15:46:02 GMT; path=/; domain=.cgewyw.site; HttpOnly; SameSite=Lax
Last-Modified: Wed, 26 Apr 2017 08:03:47 GMT
Vary: Accept-Encoding
CF-Cache-Status: DYNAMIC
Server: cloudflare
CF-RAY: 54fe57cdadcbc643-MSP
Content-Encoding: gzip
Server: nginx/1.14.1
Date: Sat, 04 Jan 2020 15:46:06 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Pragma: no-cache
X-Redirect-By: WordPress
Expires: Wed, 11 Jan 1984 05:00:00 GMT
Cache-Control: no-cache, must-revalidate, max-age=0
Set-Cookie: PHPSESSID=vv397j1iehkfgf169d8pcc8ai4; path=/
Location: https://www.piratehomerunclassic.com/
X-Endurance-Cache-Level: 0
HTTP/2 200
server: nginx/1.14.1
date: Sat, 04 Jan 2020 15:46:08 GMT
content-type: text/html; charset=UTF-8
pragma: no-cache
link: <https://www.piratehomerunclassic.com/wp-json/>; rel=
DNS Lookup ▼
DNS entries (Domain Name System) are a critical component of the Internet infrastructure. They act as directories that translate human-readable domain names (such as example.com) to machine-readable IP addresses. DNS records are stored on DNS servers and help forward internet traffic efficiently.Type | Ip | Target/Txt | TTL |
SOA | 3600 | ||
Mname | ns29.domaincontrol.com | ||
Rname | dns.jomax.net | ||
Serial Number | 2019052400 | ||
Refresh | 28800 | ||
Retry | 7200 | ||
Expire | 604800 | ||
Minimum TTL | 600 | ||
A | 184.168.221.39 | 600 | |
NS | 3600 | ||
NS | 3600 |