Ravenhawksmagickalmysticalplaces.com
403 Forbidden
Domain Summary
What IP addresses does Ravenhawksmagickalmysticalplaces.com resolve to?
• Ravenhawksmagickalmysticalplaces.com resolves to the IP addresses 173.254.28.234.
Where are Ravenhawksmagickalmysticalplaces.com servers located in?
• Ravenhawksmagickalmysticalplaces.com has servers located in United States.
ravenhawksmagickalmysticalplaces.com Profile
![ravenhawksmagickalmysticalplaces.com ravenhawksmagickalmysticalplaces.com](https://hypestat.b-cdn.net/screenshot/r/a/v/e/ravenhawksmagickalmysticalplaces.com.webp)
Title:403 Forbidden
Description:Ravenhawks Magickal Mystical Places is your Online Store for Witchcraft Supplies, Wiccan Supplies, & Occult Supplies Providing Your Magickal, Ceremonial, Spiritual & Ritual Items
ravenhawksmagickalmysticalplaces.com Traffic Analysis
There's no enough data about ravenhawksmagickalmysticalplaces.com traffic.Daily Visitors n/a
Monthly Visits n/a
Pages per Visit n/a
Visit duration n/a
Bounce Rate n/a
Is this your site?Verify your site's metrics.
- Daily Unique Visitors:
- n/a
- Monthly Visits:
- n/a
- Pages per Visit:
- n/a
- Daily Pageviews:
- n/a
- Avg. visit duration:
- n/a
- Bounce rate:
- n/a
- Global Reach:
- n/a
- HypeRank:
- n/a
Backlinks Report ▼
Ravenhawksmagickalmysticalplaces.com has a total of 176 backlinks from 53 referring domains and most of them comes from United States.- Total Backlinks:
- 176
- Follow Links:
- n/a
- Nofollow Links:
- n/a
- Referring Domains:
- 53
- Referring IPs:
- 64
- Authority Domain Score:
- 4
Backlinks by country
- Country
- Domains
- United States 20
- Netherlands 1
- Poland 1
- Singapore 1
- Italy 1
Backlinks by TLDs
- TLD Distribution
- Domains
- .com
- 34
- .dev
- 5
- .edu
- 2
- .org
- 2
- .gov
- 0
Last update was 28 days ago
This can take up to 60 seconds. Please wait...
This can take up to 60 seconds. Please wait...
*HypeStat.com is not promoting or affiliated with ravenhawksmagickalmysticalplaces.com in any way. Only publicly available statistics data are displayed.
▼
SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.- Domain:
- ravenhawksmagickalmysticalplaces.com
- Rank:
(Rank based on keywords, cost and organic traffic) - n/a
- Organic Keywords:
(Number of keywords in top 20 Google SERP) - 0
- Organic Traffic:
(Number of visitors coming from top 20 search results) - 0
- Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords) - $0.00
Ad Experience Report ▼
Summary of the ad experience rating of a website for a specific platform.Mobile summary
- Root domain:
- ravenhawksmagickalmysticalplaces.com
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Desktop summary
- Root domain:
- ravenhawksmagickalmysticalplaces.com
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Abusive Experience Report ▼
Summary of the abusive experience rating of a website.- Root domain:
- ravenhawksmagickalmysticalplaces.com
- Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.) - Off
- Status:
(The status of the site reviewed for the abusive experiences.) - Not reviewed
Where is ravenhawksmagickalmysticalplaces.com hosted? ▼
Ravenhawksmagickalmysticalplaces.com may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.- Server IP:
- 173.254.28.234
- ASN:
- AS46606
- ISP:
- Unified Layer
- Server Location:
United States, US
Other sites hosted on 173.254.28.234
How fast does ravenhawksmagickalmysticalplaces.com load? ▼
The average loading time of ravenhawksmagickalmysticalplaces.com is 216 ms.- Average Load Time:
- 216 ms
Does ravenhawksmagickalmysticalplaces.com use compression? ▼
Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on ravenhawksmagickalmysticalplaces.com are reduced by %.
ravenhawksmagickalmysticalplaces.com does not use compression.
Original size: 318 B
Compressed size: n/a
File reduced by: (%)
Compressed size: n/a
File reduced by: (%)
Google Safe Browsing ▼
Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.SSL Checker - SSL Certificate Verify ▼
An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. ravenhawksmagickalmysticalplaces.com supports HTTPS. ravenhawksmagickalmysticalplaces.com supports HTTPS
Verifying SSL Support. Please wait...
Common Name: cpcontacts.ravenhawksmagickalmysticalplaces.com
Organization:
Location:
Issuer: R3
Valid from: May 25 09:50:47 2024 GMT
Valid until: Aug 23 09:50:46 2024 GMT
Authority: CA:FALSE
Keysize: 2048 Bits
Organization:
Location:
Issuer: R3
Valid from: May 25 09:50:47 2024 GMT
Valid until: Aug 23 09:50:46 2024 GMT
Authority: CA:FALSE
Keysize: 2048 Bits
Common Name: R3
Organization: Let's Encrypt
Location: US
Issuer: ISRG Root X1
Valid from: Sep 4 00:00:00 2020 GMT
Valid until: Sep 15 16:00:00 2025 GMT
Authority: CA:TRUE
Keysize: 2048 Bits
Organization: Let's Encrypt
Location: US
Issuer: ISRG Root X1
Valid from: Sep 4 00:00:00 2020 GMT
Valid until: Sep 15 16:00:00 2025 GMT
Authority: CA:TRUE
Keysize: 2048 Bits
Verify HTTP/2 Support ▼
HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency. ravenhawksmagickalmysticalplaces.com supports HTTP/2
Verifying HTTP/2.0 Support. Please wait...
Http Header ▼
HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.content-length: 318
content-type: text/html; charset=iso-8859-1
date: Mon, 27 May 2024 09:42:02 GMT
server: Apache
DNS Lookup ▼
DNS entries (Domain Name System) are a critical component of the Internet infrastructure. They act as directories that translate human-readable domain names (such as example.com) to machine-readable IP addresses. DNS records are stored on DNS servers and help forward internet traffic efficiently.Type | Ip | Target/Txt | TTL |
HINFO | 3789 | ||
A | 173.254.28.234 | 14363 | |
NS | 172763 | ||
NS | 172763 |
Whois Lookup ▼
Domain WHOIS is a public database that provides information about domain names, including registered owners, contact information, domain registrars, registration and expiration dates, name servers, and other relevant information. Domain registration for this website began on July 29, 2007 and will expire on July 29, 2024 if not renewed. This website is now assigned through the registrar ENOM, INC.. The WHOIS data for this website's domain was last updated on July 21, 2023.- Domain Created:
- 2007-07-29
- Domain Expires:
- 2024-07-29
- Domain Updated:
- 2023-07-21
- Domain Age:
- 16 years 10 months 27 days
- Domain Registrar:
- ENOM, INC.
- Domain Owner:
- REDACTED FOR PRIVACY
- WhoIs:
Domain Name: ravenhawksmagickalmysticalplaces.com Registry Domain ID: 1116999574_DOMAIN_COM-VRSN Registrar WHOIS Server: WHOIS.ENOM.COM Registrar URL: WWW.ENOMDOMAINS.COM Updated Date: 2023-07-21T18:37:11.00Z Creation Date: 2007-07-29T00:56:37.00Z Registrar Registration Expiration Date: 2024-07-29T00:56:37.00Z Registrar: ENOM, INC. Registrar IANA ID: 48 Domain Status: clientTransferProhibited https://www.icann.org/epp#clientTransferProhibited Registrant Name: REDACTED FOR PRIVACY Registrant Organization: REDACTED FOR PRIVACY Registrant Street: REDACTED FOR PRIVACY Registrant Street: Registrant City: REDACTED FOR PRIVACY Registrant State/Province: MI Registrant Postal Code: REDACTED FOR PRIVACY Registrant Country: US Registrant Phone: REDACTED FOR PRIVACY Registrant Phone Ext: Registrant Fax: REDACTED FOR PRIVACY Registrant Email: https://tieredaccess.com/contact/0b9136e3-6892-4691-b2c3-7ca1b70e668b Admin Name: REDACTED FOR PRIVACY Admin Organization: REDACTED FOR PRIVACY Admin Street: REDACTED FOR PRIVACY Admin Street: Admin City: REDACTED FOR PRIVACY Admin State/Province: REDACTED FOR PRIVACY Admin Postal Code: REDACTED FOR PRIVACY Admin Country: REDACTED FOR PRIVACY Admin Phone: REDACTED FOR PRIVACY Admin Phone Ext: Admin Fax: REDACTED FOR PRIVACY Admin Email: REDACTED FOR PRIVACY Tech Name: REDACTED FOR PRIVACY Tech Organization: REDACTED FOR PRIVACY Tech Street: REDACTED FOR PRIVACY Tech Street: Tech City: REDACTED FOR PRIVACY Tech State/Province: REDACTED FOR PRIVACY Tech Postal Code: REDACTED FOR PRIVACY Tech Country: REDACTED FOR PRIVACY Tech Phone: REDACTED FOR PRIVACY Tech Phone Ext: Tech Fax: REDACTED FOR PRIVACY Tech Email: REDACTED FOR PRIVACY Name Server: NS1.JUSTHOST.COM Name Server: NS2.JUSTHOST.COM DNSSEC: unsigned Registrar Abuse Contact Email:Registrar Abuse Contact Phone: +1.4259744689 URL of the ICANN WHOIS Data Problem Reporting System: HTTPS://ICANN.ORG/WICF >>> Last update of WHOIS database: 2024-05-27T09:42:37.00Z