Raevskaya-repnina.com
Meggi Bogle | www.meggibogle.com
Domain Summary
What is the traffic rank for Raevskaya-repnina.com?
• Raevskaya-repnina.com ranks #8,554,631 globally on HypeStat.
What IP addresses does Raevskaya-repnina.com resolve to?
• Raevskaya-repnina.com resolves to the IP addresses 2a00:f940:4::9, 194.58.112.173.
Where are Raevskaya-repnina.com servers located in?
• Raevskaya-repnina.com has servers located in Russia.
raevskaya-repnina.com Profile

Title:Meggi Bogle | www.meggibogle.com
Description:Official website of Meggi Bogle. Hereditary military aristocracy of royal origin. CEO, Owner & Founder of the BOOST. Great-granddaughter of John Bogle.
Discover more here:
www.meggibogle.com
#meggibogle #meggiggöring #meggigoering #raevskayarepnina #annamariaserafimaraevskayarepnina #annatolstaya #annaandreeva #annashumiliova #boostcmg
Tags:
What technologies does raevskaya-repnina.com use?
These are the technologies used at raevskaya-repnina.com. raevskaya-repnina.com has a total of 10 technologies installed in 9 different categories.raevskaya-repnina.com Traffic Analysis
Raevskaya-repnina.com is ranked #8,554,631 in the world.Daily Visitors n/a
Monthly Visits n/a
Pages per Visit n/a
Visit duration n/a
Bounce Rate n/a
Is this your site?Verify your site's metrics.
- Daily Unique Visitors:
- n/a
- Monthly Visits:
- n/a
- Pages per Visit:
- n/a
- Daily Pageviews:
- n/a
- Avg. visit duration:
- n/a
- Bounce rate:
- n/a
- Global Reach:
- n/a
- HypeRank:
- 8,554,631
Backlinks Report ▼
Raevskaya-repnina.com has a total of 10 backlinks from 9 referring domains and most of them comes from Romania.- Total Backlinks:
- 10
- Follow Links:
- n/a
- Nofollow Links:
- n/a
- Referring Domains:
- 9
- Referring IPs:
- 8
- Authority Domain Score:
- 4
Backlinks by country
- Country
- Domains
- Romania 1
Backlinks by TLDs
- TLD Distribution
- Domains
- .com
- 6
- .dev
- 2
- .eu
- 1
- .edu
- 0
- .gov
- 0
Last update was 218 days ago
This can take up to 60 seconds. Please wait...
This can take up to 60 seconds. Please wait...
*HypeStat.com is not promoting or affiliated with raevskaya-repnina.com in any way. Only publicly available statistics data are displayed.
▼
SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.- Domain:
- raevskaya-repnina.com
- Rank:
(Rank based on keywords, cost and organic traffic) - n/a
- Organic Keywords:
(Number of keywords in top 20 Google SERP) - 0
- Organic Traffic:
(Number of visitors coming from top 20 search results) - 0
- Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords) - $0.00
Ad Experience Report ▼
Summary of the ad experience rating of a website for a specific platform.Mobile summary
- Root domain:
- raevskaya-repnina.com
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Desktop summary
- Root domain:
- raevskaya-repnina.com
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Abusive Experience Report ▼
Summary of the abusive experience rating of a website.- Root domain:
- raevskaya-repnina.com
- Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.) - Off
- Status:
(The status of the site reviewed for the abusive experiences.) - Not reviewed
Where is raevskaya-repnina.com hosted? ▼
Raevskaya-repnina.com may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.- Server IP:
- 2a00:f940:4::9, 194.58.112.173
- ASN:
- AS197695
- ISP:
- Domain names registrar REG.RU, Ltd
- Server Location:
Russia, RU
Other sites hosted on 194.58.112.173
How fast does raevskaya-repnina.com load? ▼
The average loading time of raevskaya-repnina.com is 1672 ms.- Average Load Time:
- 1672 ms
Does raevskaya-repnina.com use compression? ▼
Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on raevskaya-repnina.com are reduced by 83%.
raevskaya-repnina.com use br compression.
Original size: 1.23 MB
Compressed size: 205.39 KB
File reduced by: 1.03 MB (83%)
Compressed size: 205.39 KB
File reduced by: 1.03 MB (83%)
Google Safe Browsing ▼
Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.SSL Checker - SSL Certificate Verify ▼
An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. raevskaya-repnina.com supports HTTPS. raevskaya-repnina.com supports HTTPS
Verifying SSL Support. Please wait...
Common Name: *.wix.com
Organization:
Location:
Issuer: R11
Valid from: Jul 9 07:52:05 2024 GMT
Valid until: Oct 7 07:52:04 2024 GMT
Authority: CA:FALSE
Keysize: 2048 Bits
Organization:
Location:
Issuer: R11
Valid from: Jul 9 07:52:05 2024 GMT
Valid until: Oct 7 07:52:04 2024 GMT
Authority: CA:FALSE
Keysize: 2048 Bits
Common Name: *.wix.com
Organization:
Location:
Issuer: R11
Valid from: Jul 9 07:52:05 2024 GMT
Valid until: Oct 7 07:52:04 2024 GMT
Authority: CA:FALSE
Keysize: 2048 Bits
Organization:
Location:
Issuer: R11
Valid from: Jul 9 07:52:05 2024 GMT
Valid until: Oct 7 07:52:04 2024 GMT
Authority: CA:FALSE
Keysize: 2048 Bits
Common Name: R11
Organization: Let's Encrypt
Location: US
Issuer: ISRG Root X1
Valid from: Mar 13 00:00:00 2024 GMT
Valid until: Mar 12 23:59:59 2027 GMT
Authority: CA:TRUE
Keysize: 2048 Bits
Organization: Let's Encrypt
Location: US
Issuer: ISRG Root X1
Valid from: Mar 13 00:00:00 2024 GMT
Valid until: Mar 12 23:59:59 2027 GMT
Authority: CA:TRUE
Keysize: 2048 Bits
Verify HTTP/2 Support ▼
HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency. raevskaya-repnina.com supports HTTP/2
Verifying HTTP/2.0 Support. Please wait...
Http Header ▼
HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.Server: nginx
Date: Fri, 09 Aug 2024 01:15:02 GMT
Content-Type: text/html; charset=utf-8
Content-Length: 323
Connection: close
Location: https://boostcmg.wixsite.com/meggibogle
Expires: Fri, 09 Aug 2024 01:20:02 GMT
Cache-Control: max-age=300
HTTP/2 200
date: Fri, 09 Aug 2024 01:15:04 GMT
content-type: text/html; charset=UTF-8
link: <https://static.parastorage.com/>; rel=preconnect; crossorigin;,<https://static.parastorage.com/>; rel=preconnect;,<https://static.wixstatic.com/>; rel=preconnect; crossorigin;,<https://static.wixstatic.com/>; rel=preconnect;,<https://siteassets.parastorage.com>; rel=preconnect; crossorigin;,
x-wix-request-id: 1723166102.899876893953231673
html-cacheable: true
etag: W/"4bb305d93f4a5f908b14bf585da0a0f1"
content-language: en
strict-transport-security: max-age=86400
age: 0
x-seen-by: pmHZlB45NPy7b1VBAukQrewfbs+7qUVAqsIx00yI78k=,m0j2EEknGIVUW/liY8BLLhe/Ft074qYAt5jyfc2Z/bHu/2EjeiyKjB/JVOb8T5Ve,2d58ifebGbosy5xc+FRalixCAf498xLuhMysvaEv8Y1OVs/FF2usMEmw8ie+p9mvwvcAzzFUN75bumV2x8mF8A==,2UNV7KOq4oGjA5+PKsX47MDwm1CfcVIfle+nifdEv3wfbJaKSXYQ/lskq2jK6SGP,ApU9OyXBEBmlI7TXSmxGV0LJsr94nJake2VAoR/kbSw=,m86p0LbwQP79i4nFFg3YpoWxtdtgHen5JukDivoJhf9/4k3kZTsHSlYyDbKFNmXI55T7pI7m1c9hPcpLtWtenw==,nsyVGdOrEgoPIRiReBjXwAEkOJfPAlN5M6ryPfhg24w=,LoUK8/saGAmOxZWtpubo2jm94IvvY7Y1xu5ovZTKDzyIdRD8FFTtMmnf4n0r5eKYgRc83F4VMKdaOVn8iVSeYIQXJsWzL3PhWaeentdG8jY=,bW1Dh1aYg7+LEjUzti5d9BT1V1Z4xdJnfIHha8et0Ac=,Kx8FQg8qZTqABZy3EnRDz+sLiYvuSgmXAv4E+VNb4VLhK3iK8BfO8r4AjK0rlE/uPgVO0Vz+XUdPlWp6ThnUv1iB5QmpRe2J37zq9nDD6cs=
vary: Accept-Encoding
set-cookie: XSRF-TOKEN=1723166104|1sOFajrDko-S; Path=/; Domain=boostcmg.wixsite.com; Secure; SameSite=None
server-timing: cache;desc=miss, varnish;desc=miss, dc;desc=42_g
cache-control: private,max-age=0,must-revalidate
server: Pepyaka
x-content-type-options: nosniff
content-encoding: br
via: 1.1 google
glb-x-seen-by: zj+a2E71qOCweet+2KoAwKsDXK9Yj1hJlUA0MXxzy6E=
alt-svc: h3=":443"; ma=2592000,h3-29=":443"; ma=2592000
DNS Lookup ▼
DNS entries (Domain Name System) are a critical component of the Internet infrastructure. They act as directories that translate human-readable domain names (such as example.com) to machine-readable IP addresses. DNS records are stored on DNS servers and help forward internet traffic efficiently.Type | Ip | Target/Txt | TTL |
AAAA | 2a00:f940:4::9 | 86309 | |
A | 194.58.112.173 | 86309 | |
NS | 172709 | ||
NS | 172709 |
Whois Lookup ▼
Domain WHOIS is a public database that provides information about domain names, including registered owners, contact information, domain registrars, registration and expiration dates, name servers, and other relevant information. Domain registration for this website began on August 29, 2018 and will expire on August 29, 2024 if not renewed. This website is now assigned through the registrar Registrar of Domain Names REG.RU LLC. The WHOIS data for this website's domain was last updated on January 1, 0001.- Domain Created:
- 2018-08-29
- Domain Expires:
- 2024-08-29
- Domain Updated:
- 0001-01-01
- Domain Age:
- 6 years 6 months 18 days
- Domain Registrar:
- Registrar of Domain Names REG.RU LLC
- Domain Owner:
- Personal data, can not be publicly disclosed accor
- WhoIs:
Domain Name: RAEVSKAYA-REPNINA.COM Registry Domain ID: 2303894627_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.reg.com Registrar URL: https://www.reg.com Updated Date: 0001-01-01T00:00:00Z Creation Date: 2018-08-29T21:00:00Z Registrar Registration Expiration Date: 2024-08-29T21:00:00Z Registrar: Registrar of Domain Names REG.RU LLC Registrar IANA ID: 1606 Registrar Abuse Contact Email:Registrar Abuse Contact Phone: +7.4955801111 Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Registry Registrant ID: c0ihtcbmr1plymyz Registrant Name: Personal data, can not be publicly disclosed according to applicable laws. Registrant Street: Personal data, can not be publicly disclosed according to applicable laws. Registrant City: Personal data, can not be publicly disclosed according to applicable laws. Registrant Postal Code: Personal data, can not be publicly disclosed according to applicable laws. Registrant Country: Personal data, can not be publicly disclosed according to applicable laws. Registrant Phone: +7.9654006507 Registrant Phone Ext: Registrant Fax: Registrant Fax Ext: Registrant Email:
Registry Admin ID: aolqt3tv8aoqmnxo Admin Name: Personal data, can not be publicly disclosed according to applicable laws. Admin Street: Personal data, can not be publicly disclosed according to applicable laws. Admin City: Personal data, can not be publicly disclosed according to applicable laws. Admin Postal Code: Personal data, can not be publicly disclosed according to applicable laws. Admin Country: Personal data, can not be publicly disclosed according to applicable laws. Admin Phone: +7.9654006507 Admin Phone Ext: Admin Fax: +7.9654006507 Admin Fax Ext: Admin Email:
Registry Tech ID: yvtt0trnk751u8mt Tech Name: Personal data, can not be publicly disclosed according to applicable laws. Tech Street: Personal data, can not be publicly disclosed according to applicable laws. Tech City: Personal data, can not be publicly disclosed according to applicable laws. Tech Postal Code: Personal data, can not be publicly disclosed according to applicable laws. Tech Country: Personal data, can not be publicly disclosed according to applicable laws. Tech Phone: +7.9654006507 Tech Phone Ext: Tech Fax: +7.9654006507 Tech Fax Ext: Tech Email:
Name Server: ns1.reg.ru Name Server: ns2.reg.ru DNSSEC: unsigned URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/ For more information on Whois status codes, please visit: https://icann.org/epp >>> Last update of WHOIS database: 2024.08.09T01:16:22Z