raevskaya-repnina.com Raevskaya-repnina.com

   
Meggi Bogle | www.meggibogle.com

Domain Summary

What is the traffic rank for Raevskaya-repnina.com?

• Raevskaya-repnina.com ranks #8,554,631 globally on HypeStat.

What IP addresses does Raevskaya-repnina.com resolve to?

• Raevskaya-repnina.com resolves to the IP addresses 2a00:f940:4::9, 194.58.112.173.

Where are Raevskaya-repnina.com servers located in?

• Raevskaya-repnina.com has servers located in Russia.

raevskaya-repnina.com Profile

Title:Meggi Bogle | www.meggibogle.com
Description:Official website of Meggi Bogle. Hereditary military aristocracy of royal origin. CEO, Owner & Founder of the BOOST. Great-granddaughter of John Bogle. Discover more here: www.meggibogle.com #meggibogle #meggiggöring #meggigoering #raevskayarepnina #annamariaserafimaraevskayarepnina #annatolstaya #annaandreeva #annashumiliova #boostcmg
Tags:

What technologies does raevskaya-repnina.com use?

These are the technologies used at raevskaya-repnina.com. raevskaya-repnina.com has a total of 10 technologies installed in 9 different categories.

raevskaya-repnina.com Traffic Analysis

Raevskaya-repnina.com is ranked #8,554,631 in the world.
Daily Visitors n/a
Monthly Visits n/a
Pages per Visit n/a
Visit duration n/a
Bounce Rate n/a
Is this your site?Verify your site's metrics.
Daily Unique Visitors:
 n/a
Monthly Visits:
n/a
Pages per Visit:
n/a
Daily Pageviews:
n/a
Avg. visit duration:
n/a
Bounce rate:
n/a
Global Reach:
 n/a
HypeRank:
8,554,631
*All traffic values are estimates only.
Last update was 220 days ago
     
This can take up to 60 seconds. Please wait...

*HypeStat.com is not promoting or affiliated with raevskaya-repnina.com in any way. Only publicly available statistics data are displayed.

 

SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.
SemRushSemRush
Domain:
  raevskaya-repnina.com
Rank:
(Rank based on keywords, cost and organic traffic)
  n/a
Organic Keywords:
(Number of keywords in top 20 Google SERP)
  0
Organic Traffic:
(Number of visitors coming from top 20 search results)
  0
Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords)
  $0.00

Ad Experience Report

Summary of the ad experience rating of a website for a specific platform.

Mobile summary

Root domain:
raevskaya-repnina.com
Ad filtering:
(Chrome is not filtering ads on your site.)
Off
Status:
(The status of the site that is reviewed for the Better Ads Standards.)
Not reviewed

Desktop summary

Root domain:
raevskaya-repnina.com
Ad filtering:
(Chrome is not filtering ads on your site.)
Off
Status:
(The status of the site that is reviewed for the Better Ads Standards.)
Not reviewed

Abusive Experience Report

Summary of the abusive experience rating of a website.
Root domain:
raevskaya-repnina.com
Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.)
Off
Status:
(The status of the site reviewed for the abusive experiences.)
Not reviewed

Where is raevskaya-repnina.com hosted?

Raevskaya-repnina.com may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.
Server IP:
2a00:f940:4::9, 194.58.112.173
ASN:
AS197695 
ISP:
Domain names registrar REG.RU, Ltd 
Server Location:

Russia, RU
 

Other sites hosted on 194.58.112.173

How fast does raevskaya-repnina.com load?

The average loading time of raevskaya-repnina.com is 1672 ms.
Average Load Time:
1672 ms

Does raevskaya-repnina.com use compression?

Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on raevskaya-repnina.com are reduced by 83%.
raevskaya-repnina.com use br compression.
Original size: 1.23 MB
Compressed size: 205.39 KB
File reduced by: 1.03 MB (83%)

Google Safe Browsing

Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.
This site is not currently listed as suspicious

MyWot.com Reputation Ratings

MyWOT (short for "My Web of Trust") is a web-based reputation and rating service that provides users with information about the trustworthiness and safety of websites.
Status:
  SUSPICIOUS

SSL Checker - SSL Certificate Verify

An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. raevskaya-repnina.com supports HTTPS.
 raevskaya-repnina.com supports HTTPS
     
Verifying SSL Support. Please wait...
Common Name: *.wix.com
Organization:
Location:
Issuer: R11
Valid from: Jul 9 07:52:05 2024 GMT
Valid until: Oct 7 07:52:04 2024 GMT
Authority: CA:FALSE
Keysize: 2048 Bits
Common Name: *.wix.com
Organization:
Location:
Issuer: R11
Valid from: Jul 9 07:52:05 2024 GMT
Valid until: Oct 7 07:52:04 2024 GMT
Authority: CA:FALSE
Keysize: 2048 Bits
Common Name: R11
Organization: Let's Encrypt
Location: US
Issuer: ISRG Root X1
Valid from: Mar 13 00:00:00 2024 GMT
Valid until: Mar 12 23:59:59 2027 GMT
Authority: CA:TRUE
Keysize: 2048 Bits

Verify HTTP/2 Support

HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency.
 raevskaya-repnina.com supports HTTP/2
     
Verifying HTTP/2.0 Support. Please wait...

Http Header

HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.
Server: nginx
Date: Fri, 09 Aug 2024 01:15:02 GMT
Content-Type: text/html; charset=utf-8
Content-Length: 323
Connection: close
Location: https://boostcmg.wixsite.com/meggibogle
Expires: Fri, 09 Aug 2024 01:20:02 GMT
Cache-Control: max-age=300

HTTP/2 200 
date: Fri, 09 Aug 2024 01:15:04 GMT
content-type: text/html; charset=UTF-8
link: <https://static.parastorage.com/>; rel=preconnect; crossorigin;,<https://static.parastorage.com/>; rel=preconnect;,<https://static.wixstatic.com/>; rel=preconnect; crossorigin;,<https://static.wixstatic.com/>; rel=preconnect;,<https://siteassets.parastorage.com>; rel=preconnect; crossorigin;,
x-wix-request-id: 1723166102.899876893953231673
html-cacheable: true
etag: W/"4bb305d93f4a5f908b14bf585da0a0f1"
content-language: en
strict-transport-security: max-age=86400
age: 0
x-seen-by: pmHZlB45NPy7b1VBAukQrewfbs+7qUVAqsIx00yI78k=,m0j2EEknGIVUW/liY8BLLhe/Ft074qYAt5jyfc2Z/bHu/2EjeiyKjB/JVOb8T5Ve,2d58ifebGbosy5xc+FRalixCAf498xLuhMysvaEv8Y1OVs/FF2usMEmw8ie+p9mvwvcAzzFUN75bumV2x8mF8A==,2UNV7KOq4oGjA5+PKsX47MDwm1CfcVIfle+nifdEv3wfbJaKSXYQ/lskq2jK6SGP,ApU9OyXBEBmlI7TXSmxGV0LJsr94nJake2VAoR/kbSw=,m86p0LbwQP79i4nFFg3YpoWxtdtgHen5JukDivoJhf9/4k3kZTsHSlYyDbKFNmXI55T7pI7m1c9hPcpLtWtenw==,nsyVGdOrEgoPIRiReBjXwAEkOJfPAlN5M6ryPfhg24w=,LoUK8/saGAmOxZWtpubo2jm94IvvY7Y1xu5ovZTKDzyIdRD8FFTtMmnf4n0r5eKYgRc83F4VMKdaOVn8iVSeYIQXJsWzL3PhWaeentdG8jY=,bW1Dh1aYg7+LEjUzti5d9BT1V1Z4xdJnfIHha8et0Ac=,Kx8FQg8qZTqABZy3EnRDz+sLiYvuSgmXAv4E+VNb4VLhK3iK8BfO8r4AjK0rlE/uPgVO0Vz+XUdPlWp6ThnUv1iB5QmpRe2J37zq9nDD6cs=
vary: Accept-Encoding
set-cookie: XSRF-TOKEN=1723166104|1sOFajrDko-S; Path=/; Domain=boostcmg.wixsite.com; Secure; SameSite=None
server-timing: cache;desc=miss, varnish;desc=miss, dc;desc=42_g
cache-control: private,max-age=0,must-revalidate
server: Pepyaka
x-content-type-options: nosniff
content-encoding: br
via: 1.1 google
glb-x-seen-by: zj+a2E71qOCweet+2KoAwKsDXK9Yj1hJlUA0MXxzy6E=
alt-svc: h3=":443"; ma=2592000,h3-29=":443"; ma=2592000

DNS Lookup

DNS entries (Domain Name System) are a critical component of the Internet infrastructure. They act as directories that translate human-readable domain names (such as example.com) to machine-readable IP addresses. DNS records are stored on DNS servers and help forward internet traffic efficiently.
Type Ip Target/Txt TTL
AAAA 2a00:f940:4::9 86309
A 194.58.112.173 86309
NS ns1.reg.ru 172709
NS ns2.reg.ru 172709

Whois Lookup

Domain WHOIS is a public database that provides information about domain names, including registered owners, contact information, domain registrars, registration and expiration dates, name servers, and other relevant information. Domain registration for this website began on August 29, 2018 and will expire on August 29, 2024 if not renewed. This website is now assigned through the registrar Registrar of Domain Names REG.RU LLC. The WHOIS data for this website's domain was last updated on January 1, 0001.
Domain Created:
2018-08-29
Domain Expires:
2024-08-29
Domain Updated:
0001-01-01
Domain Age:
6 years 6 months 19 days
Domain Registrar:
Registrar of Domain Names REG.RU LLC
Domain Owner:
Personal data, can not be publicly disclosed accor
WhoIs:
 

Domain Name: RAEVSKAYA-REPNINA.COM
Registry Domain ID: 2303894627_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.reg.com
Registrar URL: https://www.reg.com
Updated Date: 0001-01-01T00:00:00Z
Creation Date: 2018-08-29T21:00:00Z
Registrar Registration Expiration Date: 2024-08-29T21:00:00Z
Registrar: Registrar of Domain Names REG.RU LLC
Registrar IANA ID: 1606
Registrar Abuse Contact Email: email
Registrar Abuse Contact Phone: +7.4955801111
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID: c0ihtcbmr1plymyz
Registrant Name: Personal data, can not be publicly disclosed according to applicable laws.
Registrant Street: Personal data, can not be publicly disclosed according to applicable laws.
Registrant City: Personal data, can not be publicly disclosed according to applicable laws.
Registrant Postal Code: Personal data, can not be publicly disclosed according to applicable laws.
Registrant Country: Personal data, can not be publicly disclosed according to applicable laws.
Registrant Phone: +7.9654006507
Registrant Phone Ext:
Registrant Fax: 
Registrant Fax Ext:
Registrant Email: email
Registry Admin ID: aolqt3tv8aoqmnxo
Admin Name: Personal data, can not be publicly disclosed according to applicable laws.
Admin Street: Personal data, can not be publicly disclosed according to applicable laws.
Admin City: Personal data, can not be publicly disclosed according to applicable laws.
Admin Postal Code: Personal data, can not be publicly disclosed according to applicable laws.
Admin Country: Personal data, can not be publicly disclosed according to applicable laws.
Admin Phone: +7.9654006507
Admin Phone Ext:
Admin Fax: +7.9654006507
Admin Fax Ext:
Admin Email: email
Registry Tech ID: yvtt0trnk751u8mt
Tech Name: Personal data, can not be publicly disclosed according to applicable laws.
Tech Street: Personal data, can not be publicly disclosed according to applicable laws.
Tech City: Personal data, can not be publicly disclosed according to applicable laws.
Tech Postal Code: Personal data, can not be publicly disclosed according to applicable laws.
Tech Country: Personal data, can not be publicly disclosed according to applicable laws.
Tech Phone: +7.9654006507
Tech Phone Ext:
Tech Fax: +7.9654006507
Tech Fax Ext:
Tech Email: email
Name Server: ns1.reg.ru
Name Server: ns2.reg.ru
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
For more information on Whois status codes, please visit: https://icann.org/epp
>>> Last update of WHOIS database: 2024.08.09T01:16:22Z