lacanadaflintridgechimneysweep.us Lacanadaflintridgechimneysweep.us

   
Chimney Sweep & Cleaning La Canada Flintridge (818) 876-5455 Call us to Chimney Sweeping Near Me

Domain Summary

What IP addresses does Lacanadaflintridgechimneysweep.us resolve to?

• Lacanadaflintridgechimneysweep.us resolves to the IP addresses 188.114.96.3.

lacanadaflintridgechimneysweep.us Profile

Title:Chimney Sweep & Cleaning La Canada Flintridge (818) 876-5455 Call us to Chimney Sweeping Near Me Description:(818) 876-5455 We offer a network of pros with a full line of fireplace and chimney cleaning solutions in La Canada Flintridge. High level of professionalism and quality in everything the experts do.

What technologies does lacanadaflintridgechimneysweep.us use?

These are the technologies used at lacanadaflintridgechimneysweep.us. lacanadaflintridgechimneysweep.us has a total of 7 technologies installed in 6 different categories.

lacanadaflintridgechimneysweep.us Traffic Analysis

There's no enough data about lacanadaflintridgechimneysweep.us traffic.
Daily Visitors n/a
Monthly Visits n/a
Pages per Visit n/a
Visit duration n/a
Bounce Rate n/a
Is this your site?Verify your site's metrics.
Daily Unique Visitors:
 n/a
Monthly Visits:
n/a
Pages per Visit:
n/a
Daily Pageviews:
n/a
Avg. visit duration:
n/a
Bounce rate:
n/a
Global Reach:
 n/a
HypeRank:
n/a
*All traffic values are estimates only.
Last update was 10 hours ago
     
This can take up to 60 seconds. Please wait...

Update will be available in 14 hours
*HypeStat.com is not promoting or affiliated with lacanadaflintridgechimneysweep.us in any way. Only publicly available statistics data are displayed.

 

SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.
SemRushSemRush
Domain:
  lacanadaflintridgechimneysweep.us
Rank:
(Rank based on keywords, cost and organic traffic)
  n/a
Organic Keywords:
(Number of keywords in top 20 Google SERP)
  0
Organic Traffic:
(Number of visitors coming from top 20 search results)
  0
Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords)
  $0.00

Ad Experience Report

Summary of the ad experience rating of a website for a specific platform.

Mobile summary

Root domain:
lacanadaflintridgechimneysweep.us
Ad filtering:
(Chrome is not filtering ads on your site.)
Off
Status:
(The status of the site that is reviewed for the Better Ads Standards.)
Not reviewed

Desktop summary

Root domain:
lacanadaflintridgechimneysweep.us
Ad filtering:
(Chrome is not filtering ads on your site.)
Off
Status:
(The status of the site that is reviewed for the Better Ads Standards.)
Not reviewed

Abusive Experience Report

Summary of the abusive experience rating of a website.
Root domain:
lacanadaflintridgechimneysweep.us
Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.)
Off
Status:
(The status of the site reviewed for the abusive experiences.)
Not reviewed

Where is lacanadaflintridgechimneysweep.us hosted?

Lacanadaflintridgechimneysweep.us may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.
Server IP:
188.114.96.3
ASN:
AS13335 
ISP:
Cloudflare Inc 
Server Location:


 

Other sites hosted on 188.114.96.3

How fast does lacanadaflintridgechimneysweep.us load?

The average loading time of lacanadaflintridgechimneysweep.us is 1069 ms. The Desktop speed index is 97 and mobile speed index is 84.
Average Load Time:
1069 ms

Page Speed (Google PageSpeed Insights) - Desktop

97
0-49 50-89 90-100 i

Field Data

Over the last 30 days, the field data shows that this page has a speed compared to other pages in the Chrome User Experience Report.We are showing the 90th percentile of FCP and the 95th percentile of FID.

Cumulative Layout Shift (CLS)0 0% of loads for this page have a fast (<0s) Cumulative Layout Shift (CLS) 0% 0% of loads for this page have an average (0s ~ 0s) Cumulative Layout Shift (CLS) 0% 0% of loads for this page have a slow (>0s) Cumulative Layout Shift (CLS) 0%
Time To First Byte (TTFB)0 0% of loads for this page have a fast (<0s) Time To First Byte (TTFB) 0% 0% of loads for this page have an average (0s ~ 0s) Time To First Byte (TTFB) 0% 0% of loads for this page have a slow (>0s) Time To First Byte (TTFB) 0%
First Contentful Paint (FCP)0 0% of loads for this page have a fast (<0s) First Contentful Paint (FCP) 0% 0% of loads for this page have an average (0s ~ 0s) First Contentful Paint (FCP) 0% 0% of loads for this page have a slow (>0s) First Contentful Paint (FCP) 0%
First Input Delay (FID)0 0% of loads for this page have a fast (<0ms) First Input Delay (FID) 0% 0% of loads for this page have an average (0ms ~ 0ms) First Input Delay (FID) 0% 0% of loads for this page have a slow (>0ms) First Input Delay (FID) 0%
Interaction To Next Paint (INP)0 0% of loads for this page have a fast (<0ms) Interaction To Next Paint (INP) 0% 0% of loads for this page have an average (0ms ~ 0ms) Interaction To Next Paint (INP) 0% 0% of loads for this page have a slow (>0ms) Interaction To Next Paint (INP) 0%
Largest Contentful Paint (LCP)0 0% of loads for this page have a fast (<0ms) Largest Contentful Paint (LCP) 0% 0% of loads for this page have an average (0ms ~ 0ms) Largest Contentful Paint (LCP) 0% 0% of loads for this page have a slow (>0ms) Largest Contentful Paint (LCP) 0%

Origin Data

All pages served from this origin have an speed compared to other pages in the Chrome User Experience Report. over the last 30 days.To view suggestions tailored to each page, analyze individual page URLs.

Cumulative Layout Shift (CLS)0 0% of loads for this page have a fast (<0s) Cumulative Layout Shift (CLS) 0% 0% of loads for this page have an average (0s ~ 0s) Cumulative Layout Shift (CLS) 0% 0% of loads for this page have a slow (>0s) Cumulative Layout Shift (CLS) 0%
Time To First Byte (TTFB)0 0% of loads for this page have a fast (<0s) Time To First Byte (TTFB) 0% 0% of loads for this page have an average (0s ~ 0s) Time To First Byte (TTFB) 0% 0% of loads for this page have a slow (>0s) Time To First Byte (TTFB) 0%
First Contentful Paint (FCP)0 0% of loads for this page have a fast (<0s) First Contentful Paint (FCP) 0% 0% of loads for this page have an average (0s ~ 0s) First Contentful Paint (FCP) 0% 0% of loads for this page have a slow (>0s) First Contentful Paint (FCP) 0%
First Input Delay (FID)0 0% of loads for this page have a fast (<0ms) First Input Delay (FID) 0% 0% of loads for this page have an average 0ms ~ 0ms) First Input Delay (FID) 0% 0% of loads for this page have a slow (>0ms) First Input Delay (FID) 0%
Interaction To Next Paint (INP)0 0% of loads for this page have a fast (<0ms) Interaction To Next Paint (INP) 0% 0% of loads for this page have an average (0ms ~ 0ms) Interaction To Next Paint (INP) 0% 0% of loads for this page have a slow (>0ms) Interaction To Next Paint (INP) 0%
Largest Contentful Paint (LCP)0 0% of loads for this page have a fast (<0ms) Largest Contentful Paint (LCP) 0% 0% of loads for this page have an average (0ms ~ 0ms) Largest Contentful Paint (LCP) 0% 0% of loads for this page have a slow (>0ms) Largest Contentful Paint (LCP) 0%

Lab Data

First Contentful Paint 0.8 s
First Contentful Paint marks the time at which the first text or image is painted. Learn more about the First Contentful Paint metric
Largest Contentful Paint 0.8 s
Largest Contentful Paint marks the time at which the largest text or image is painted. Learn more about the Largest Contentful Paint metric
INP breakdown  
Start investigating by looking at the longest subpart. how to improve INP
Max Potential First Input Delay 80 ms
The maximum potential First Input Delay that your users could experience is the duration of the longest task. Learn more about the Maximum Potential First Input Delay metric
Speed Index 1.1 s
Speed Index shows how quickly the contents of a page are visibly populated. Learn more about the Speed Index metric
Time to Interactive 1.0 s
Time to Interactive is the amount of time it takes for the page to become fully interactive. Learn more about the Time to Interactive metric
LCP request discovery  
by making the LCP image discoverable from the HTML immediately, and avoiding lazy-loading Optimize LCP
Total Blocking Time 10 ms
Sum of all time periods between FCP and Time to Interactive, when task length exceeded 50ms, expressed in milliseconds. Learn more about the Total Blocking Time metric

Page Speed (Google PageSpeed Insights) - Mobile

84
0-49 50-89 90-100 i

Field Data

Over the last 30 days, the field data shows that this page has a speed compared to other pages in the Chrome User Experience Report.We are showing the 90th percentile of FCP and the 95th percentile of FID.

Cumulative Layout Shift (CLS)0 0% of loads for this page have a fast (<0s) Cumulative Layout Shift (CLS) 0% 0% of loads for this page have an average (0s ~ 0s) Cumulative Layout Shift (CLS) 0% 0% of loads for this page have a slow (>0s) Cumulative Layout Shift (CLS) 0%
Time To First Byte (TTFB)0 0% of loads for this page have a fast (<0s) Time To First Byte (TTFB) 0% 0% of loads for this page have an average (0s ~ 0s) Time To First Byte (TTFB) 0% 0% of loads for this page have a slow (>0s) Time To First Byte (TTFB) 0%
First Contentful Paint (FCP)0 0% of loads for this page have a fast (<0s) First Contentful Paint (FCP) 0% 0% of loads for this page have an average (0s ~ 0s) First Contentful Paint (FCP) 0% 0% of loads for this page have a slow (>0s) First Contentful Paint (FCP) 0%
First Input Delay (FID)0 0% of loads for this page have a fast (<0ms) First Input Delay (FID) 0% 0% of loads for this page have an average (0ms ~ 0ms) First Input Delay (FID) 0% 0% of loads for this page have a slow (>0ms) First Input Delay (FID) 0%
Interactive To Next Paint (INP)0 0% of loads for this page have a fast (<0s) Interactive To Next Paint (INP) 0% 0% of loads for this page have an average (0s ~ 0s) Interactive To Next Paint (INP) 0% 0% of loads for this page have a slow (>0s) Interactive To Next Paint (INP) 0%
Largest Contentful Paint (LCP)0 0% of loads for this page have a fast (<0s) Largest Contentful Paint (LCP) 0% 0% of loads for this page have an average (0s ~ 0s) Largest Contentful Paint (LCP) 0% 0% of loads for this page have a slow (>0s) Largest Contentful Paint (LCP) 0%

Origin Data

All pages served from this origin have an speed compared to other pages in the Chrome User Experience Report. over the last 30 days.To view suggestions tailored to each page, analyze individual page URLs.

Cumulative Layout Shift (CLS)0 0% of loads for this page have a fast (<0s) Cumulative Layout Shift (CLS) 0% 0% of loads for this page have an average (0s ~ 0s) Cumulative Layout Shift (CLS) 0% 0% of loads for this page have a slow (>0s) Cumulative Layout Shift (CLS) 0%
Time To First Byte (TTFB)0 0% of loads for this page have a fast (<0s) Time To First Byte (TTFB) 0% 0% of loads for this page have an average (0s ~ 0s) Time To First Byte (TTFB) 0% 0% of loads for this page have a slow (>0s) Time To First Byte (TTFB) 0%
First Contentful Paint (FCP)0 0% of loads for this page have a fast (<0s) First Contentful Paint (FCP) 0% 0% of loads for this page have an average (0s ~ 0s) First Contentful Paint (FCP) 0% 0% of loads for this page have a slow (>0s) First Contentful Paint (FCP) 0%
First Input Delay (FID)0 0% of loads for this page have a fast (<0ms) First Input Delay (FID) 0% 0% of loads for this page have an average 0ms ~ 0ms) First Input Delay (FID) 0% 0% of loads for this page have a slow (>0ms) First Input Delay (FID) 0%
Interactive To Next Paint (INP)0 0% of loads for this page have a fast (<0s) Interactive To Next Paint (INP) 0% 0% of loads for this page have an average (0s ~ 0s) Interactive To Next Paint (INP) 0% 0% of loads for this page have a slow (>0s) Interactive To Next Paint (INP) 0%
Largest Contentful Paint (LCP)0 0% of loads for this page have a fast (<0s)Largest Contentful Paint (LCP) 0% 0% of loads for this page have an average (0s ~ 0s)Largest Contentful Paint (LCP) 0% 0% of loads for this page have a slow (>0s)Largest Contentful Paint (LCP) 0%

Lab Data

Speed Index 7.0 s
Speed Index shows how quickly the contents of a page are visibly populated. Learn more about the Speed Index metric
Total Blocking Time 50 ms
Sum of all time periods between FCP and Time to Interactive, when task length exceeded 50ms, expressed in milliseconds. Learn more about the Total Blocking Time metric
INP breakdown  
Start investigating by looking at the longest subpart. how to improve INP
Max Potential First Input Delay 80 ms
The maximum potential First Input Delay that your users could experience is the duration of the longest task. Learn more about the Maximum Potential First Input Delay metric
LCP request discovery  
by making the LCP image discoverable from the HTML immediately, and avoiding lazy-loading Optimize LCP
Time to Interactive 4.1 s
Time to Interactive is the amount of time it takes for the page to become fully interactive. Learn more about the Time to Interactive metric
First Contentful Paint 2.8 s
First Contentful Paint marks the time at which the first text or image is painted. Learn more about the First Contentful Paint metric
Largest Contentful Paint 2.8 s
Largest Contentful Paint marks the time at which the largest text or image is painted. Learn more about the Largest Contentful Paint metric

Does lacanadaflintridgechimneysweep.us use compression?

Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on lacanadaflintridgechimneysweep.us are reduced by 86%.
lacanadaflintridgechimneysweep.us use br compression.
Original size: 121.61 KB
Compressed size: 16.13 KB
File reduced by: 105.49 KB (86%)

Google Safe Browsing

Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.
This site is not currently listed as suspicious

MyWot.com Reputation Ratings

MyWOT (short for "My Web of Trust") is a web-based reputation and rating service that provides users with information about the trustworthiness and safety of websites.
Status:
  NOT_SAFE

SSL Checker - SSL Certificate Verify

An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. lacanadaflintridgechimneysweep.us supports HTTPS.
 lacanadaflintridgechimneysweep.us supports HTTPS
     
Verifying SSL Support. Please wait...
Common Name: lacanadaflintridgechimneysweep.us
Organization:
Location:
Issuer: WE1
Valid from: Sep 18 20:44:29 2025 GMT
Valid until: Dec 17 21:43:04 2025 GMT
Authority: CA:FALSE
Keysize:
Common Name: WE1
Organization: Google Trust Services
Location: US
Issuer: GTS Root R4
Valid from: Dec 13 09:00:00 2023 GMT
Valid until: Feb 20 14:00:00 2029 GMT
Authority: CA:TRUE
Keysize:
Common Name: GTS Root R4
Organization: Google Trust Services LLC
Location: US
Issuer: GlobalSign Root CA
Valid from: Nov 15 03:43:21 2023 GMT
Valid until: Jan 28 00:00:42 2028 GMT
Authority: CA:TRUE
Keysize:

Verify HTTP/2 Support

HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency.
 lacanadaflintridgechimneysweep.us supports HTTP/2
     
Verifying HTTP/2.0 Support. Please wait...

Http Header

HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.
date: Tue, 21 Oct 2025 14:15:02 GMT
location: https://www.lacanadaflintridgechimneysweep.us/
vary: accept-encoding
report-to: {"group":"cf-nel","max_age":604800,"endpoints":[{"url":"https://a.nel.cloudflare.com/report/v4?s=GiscAG%2B0zpkY3L3NPSdAdRkmnas%2Fl0fypE4qRPyBzCjZX018oq%2BhD%2FMaPuyPhMqtktv%2FEZDLlYnhfodCzaa9MgI44vY774lJMLTpEzHuBeE0qwXASIzutYMwS5%2BQXIKvwdBZP7mB3dwiz9n0TQ%3D%3D"}]}
nel: {"report_to":"cf-nel","success_fraction":0.0,"max_age":604800}
server: cloudflare
cf-ray: 99215d5de83e0b0c-FRA
alt-svc: h3=":443"; ma=86400

HTTP/2 200 
date: Tue, 21 Oct 2025 14:15:02 GMT
content-type: text/html; charset=utf-8
server: cloudflare
nel: {"report_to":"cf-nel","success_fraction":0.0,"max_age":604800}
x-powered-by: Next.js
cache-control: private, no-cache, no-store, max-age=0, must-revalidate
vary: Accept-Encoding
report-to: {"group":"cf-nel","max_age":604800,"endpoints":[{"url":"https://a.nel.cloudflare.com/report/v4?s=o4Q%2Byn19PLH7ISjuLpO%2FsUcNtT6fhMxAI0kmMsxD%2Bro1%2Fdjz%2B7VqZXznnlFdCkW%2BBojB%2B5ABg5uIZGL%2Ba5Vw%2FAdZTXV2Q7JN1S28r%2FJKmaK7jgXo8IZBXQHRyrYmZJfN6aK3%2F%2BO8o4HQYtnhb%2FKbKMs%3D"}]}
cf-cache-status: DYNAMIC
content-encoding: br
cf-ray: 99215d5e1e4003ac-FRA
alt-svc: h3=":443"; ma=86400

DNS Lookup

DNS entries (Domain Name System) are a critical component of the Internet infrastructure. They act as directories that translate human-readable domain names (such as example.com) to machine-readable IP addresses. DNS records are stored on DNS servers and help forward internet traffic efficiently.
Type Ip Target/Txt TTL
A 188.114.96.3 251
A 188.114.97.3 251