Kevinwilliamslandscapedesign.com
Williams Landscape Design | Landscape Services | Jackson, MO
Domain Summary
What is the traffic rank for Kevinwilliamslandscapedesign.com?
• Kevinwilliamslandscapedesign.com ranks #7,043,459 globally on HypeStat.
What percent of global Internet users visit Kevinwilliamslandscapedesign.com?
• 1.0E-7% of global Internet users visit Kevinwilliamslandscapedesign.com
How many people visit Kevinwilliamslandscapedesign.com each day?
• Kevinwilliamslandscapedesign.com receives approximately 3 visitors and 3 page impressions per day.
How much Kevinwilliamslandscapedesign.com can earn?
• Kevinwilliamslandscapedesign.com should earn about $0.01/day from advertising revenue.
What is Kevinwilliamslandscapedesign.com estimated value?
• Estimated value of Kevinwilliamslandscapedesign.com is $10.67.
What IP addresses does Kevinwilliamslandscapedesign.com resolve to?
• Kevinwilliamslandscapedesign.com resolves to the IP addresses 205.147.88.159.
Where are Kevinwilliamslandscapedesign.com servers located in?
• Kevinwilliamslandscapedesign.com has servers located in Ashburn, Virginia, 20147, United States.
kevinwilliamslandscapedesign.com Profile
Title:
Williams Landscape Design | Landscape Services | Jackson, MO
Description:Lawn treatment. Landscape installations. Hardscapes. Call us for a free estimate.
kevinwilliamslandscapedesign.com Traffic Analysis
Kevinwilliamslandscapedesign.com is ranked #7,043,459 in the world. This website is viewed by an estimated 3 visitors daily, generating a total of 3 pageviews. This equates to about 90.9 monthly visitors. Kevinwilliamslandscapedesign.com traffic has increased by 17.95% compared to last month.Daily Visitors3
41.03%
Monthly Visits90.9
17.95%
Pages per Visit1.00
Visit duration n/a
Bounce Rate100.00%
Is this your site?Verify your site's metrics.
- Daily Unique Visitors:
- 3
- Monthly Visits:
- 91
- Pages per Visit:
- 1.00
- Daily Pageviews:
- 3
- Avg. visit duration:
- n/a
- Bounce rate:
- 100.00%
- Global Reach:
- 1.0E-7%
- Monthly Visits (SEMrush):
- 92
- Monthly Unique Visitors (SEMrush):
- 46
- HypeRank:
- 7,043,459
- SEMrush Rank:
- 5,143,856
- SimilarWeb Rank:
- 31,071,163
Traffic sources
- Direct:
- 100.00%
- Referral:
- 0%
- Search:
- 0%
- Social:
- 0%
- Paid:
- 0%
Desktop vs Mobile
- Desktop:
- 100.00%
- Mobile:
- 0%
Total Visits Last 3 Months
60
JUL
77.1
AUG
90.9
SEP
Backlinks Report ▼
Kevinwilliamslandscapedesign.com has a total of 9 backlinks from 9 referring domains and most of them comes from United States.- Total Backlinks:
- 9
- Follow Links:
- n/a
- Nofollow Links:
- n/a
- Referring Domains:
- 9
- Referring IPs:
- 9
- Authority Domain Score:
- 7
Backlinks by country
- Country
- Domains
- United States 1
Backlinks by TLDs
- TLD Distribution
- Domains
- .com
- 7
- .dev
- 2
- .edu
- 0
- .gov
- 0
Last update was 371 days ago
This can take up to 60 seconds. Please wait...
This can take up to 60 seconds. Please wait...
*HypeStat.com is not promoting or affiliated with kevinwilliamslandscapedesign.com in any way. Only publicly available statistics data are displayed.
Search Engine Indexes ▼
Search engine indexes are huge databases or collections of net pages that search engines like google like google and yahoo use to retrieve applicable facts while customers carry out searches. These indexes are created through search engines like google and yahoo through crawling and indexing net pages from throughout the internet.- Bing Index:
- 13
▼
SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.- Domain:
- kevinwilliamslandscapedesign.com
- Rank:
(Rank based on keywords, cost and organic traffic) - 5,143,856
- Organic Keywords:
(Number of keywords in top 20 Google SERP) - 25
- Organic Traffic:
(Number of visitors coming from top 20 search results) - 41
- Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords) - $183.00
Revenue report ▼
Google.com would generate approximately $0 per day if the source of income were advertisements, which equates to an estimated monthly revenue of $0.3 and annual gross revenue of approximately $3.7. Based on these figures, the site's net worth is estimated at around $10.7.How much would kevinwilliamslandscapedesign.com make?
- Daily Revenue:
- $0.01
- Monthly Revenue:
- $0.30
- Yearly Revenue:
- $3.65
How much is kevinwilliamslandscapedesign.com worth?
- Website Value:
- $10.7
Ad Experience Report ▼
Summary of the ad experience rating of a website for a specific platform.Mobile summary
- Root domain:
- kevinwilliamslandscapedesign.com
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Desktop summary
- Root domain:
- kevinwilliamslandscapedesign.com
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Abusive Experience Report ▼
Summary of the abusive experience rating of a website.- Root domain:
- kevinwilliamslandscapedesign.com
- Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.) - Off
- Status:
(The status of the site reviewed for the abusive experiences.) - Not reviewed
Where is kevinwilliamslandscapedesign.com hosted? ▼
Kevinwilliamslandscapedesign.com may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.- Server IP:
- 205.147.88.159
- ASN:
- AS31898
- ISP:
- Oracle Corporation
- Server Location:
- Ashburn
Virginia, VA
20147
United States, US
Other sites hosted on 205.147.88.159
How fast does kevinwilliamslandscapedesign.com load? ▼
The average loading time of kevinwilliamslandscapedesign.com is 308 ms.- Average Load Time:
- 308 ms
Does kevinwilliamslandscapedesign.com use compression? ▼
Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on kevinwilliamslandscapedesign.com are reduced by 69%.
kevinwilliamslandscapedesign.com use gzip compression.
Original size: 261.23 KB
Compressed size: 78.77 KB
File reduced by: 182.46 KB (69%)
Compressed size: 78.77 KB
File reduced by: 182.46 KB (69%)
Google Safe Browsing ▼
Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.SSL Checker - SSL Certificate Verify ▼
An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. kevinwilliamslandscapedesign.com supports HTTPS. kevinwilliamslandscapedesign.com supports HTTPS
Verifying SSL Support. Please wait...
Common Name: www.kevinwilliamslandscapedesign.com
Organization:
Location:
Issuer: R10
Valid from: Sep 24 23:45:19 2024 GMT
Valid until: Dec 23 23:45:18 2024 GMT
Authority: CA:FALSE
Keysize: 4096 Bits
Organization:
Location:
Issuer: R10
Valid from: Sep 24 23:45:19 2024 GMT
Valid until: Dec 23 23:45:18 2024 GMT
Authority: CA:FALSE
Keysize: 4096 Bits
Common Name: R10
Organization: Let's Encrypt
Location: US
Issuer: ISRG Root X1
Valid from: Mar 13 00:00:00 2024 GMT
Valid until: Mar 12 23:59:59 2027 GMT
Authority: CA:TRUE
Keysize: 2048 Bits
Organization: Let's Encrypt
Location: US
Issuer: ISRG Root X1
Valid from: Mar 13 00:00:00 2024 GMT
Valid until: Mar 12 23:59:59 2027 GMT
Authority: CA:TRUE
Keysize: 2048 Bits
Verify HTTP/2 Support ▼
HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency. kevinwilliamslandscapedesign.com does not support HTTP/2
Verifying HTTP/2.0 Support. Please wait...
Http Header ▼
HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.Content-Type: text/html
Connection: keep-alive
Content-Length: 157
X-Zen-Fury: 644437884661cbd403a28a924a713fe28eeabe7a
Date: Wed, 30 Oct 2024 18:03:02 GMT
Server: ZENEDGE
Location: https://www.kevinwilliamslandscapedesign.com/
X-Cdn: Served-By-Zenedge
HTTP/1.1 200 OK
Content-Type: text/html;charset=utf-8
Transfer-Encoding: chunked
Connection: keep-alive
X-Content-Type-Options: nosniff
Strict-Transport-Security: max-age=31536000; preload
X-Frame-Options: SAMEORIGIN
Vary: user-agent,accept-encoding
Speculation-Rules: "https://static-res-cdn.websites.hibu.com/speculations/rules/prerender-1.0.3.json"
Cache-Control: no-store
Cache-Control: no-cache, no-store, must-revalidate
Cache-Control: max-age=0
X-Zen-Fury: 35e2ef63a19befeed89a741c711c5608a55c6d52
d-cache: from-cache
D-Geo: US
Server: ZENEDGE
X-Cache-Status: MISS
Date: Wed, 30 Oct 2024 18:03:02 GMT
Content-Security-Policy: frame-ancestors 'self'
Expires: Thu, 01 Jan 1970 00:00:00 GMT
Link: <https://le-cdn.hibuwebsites.com/c95002068e014bd9be7e3b5ee010d858/dms3rep/multi/opt/1-1920w.png>; rel=preload; as=image; fetchpriority=high
X-Cdn: Served-By-Zenedge
Content-Encoding: gzip
DNS Lookup ▼
DNS entries (Domain Name System) are a critical component of the Internet infrastructure. They act as directories that translate human-readable domain names (such as example.com) to machine-readable IP addresses. DNS records are stored on DNS servers and help forward internet traffic efficiently.| Type | Ip | Target/Txt | TTL |
| SOA | 300 | ||
| Mname | ns1.systemdns.com | ||
| Rname | hostmaster.systemdns.com | ||
| Serial Number | 1710898006 | ||
| Refresh | 10800 | ||
| Retry | 3600 | ||
| Expire | 1209600 | ||
| Minimum TTL | 60 | ||
| TXT | 300 | ||
| MX | 300 | ||
| A | 205.147.88.159 | 214 | |
| NS | 300 | ||
| NS | 300 | ||
| NS | 300 |
Whois Lookup ▼
Domain WHOIS is a public database that provides information about domain names, including registered owners, contact information, domain registrars, registration and expiration dates, name servers, and other relevant information. Domain registration for this website began on October 6, 2010 and will expire on October 6, 2025 if not renewed. This website is now assigned through the registrar Tucows Domains Inc.. The WHOIS data for this website's domain was last updated on September 7, 2024.- Domain Created:
- 2010-10-06
- Domain Expires:
- 2025-10-06
- Domain Updated:
- 2024-09-07
- Domain Age:
- 15 years 1 months
- Domain Registrar:
- Tucows Domains Inc.
- WhoIs:
Domain Name: KEVINWILLIAMSLANDSCAPEDESIGN.COM Registry Domain ID: 1619106897_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.tucows.com Registrar URL: http://www.tucows.com Updated Date: 2024-09-07T04:33:57Z Creation Date: 2010-10-06T08:12:17Z Registry Expiry Date: 2025-10-06T08:12:17Z Registrar: Tucows Domains Inc. Registrar IANA ID: 69 Registrar Abuse Contact Email:Registrar Abuse Contact Phone: +1.4165350123 Domain Status: ok https://icann.org/epp#ok Name Server: NS1.SYSTEMDNS.COM Name Server: NS2.SYSTEMDNS.COM Name Server: NS3.SYSTEMDNS.COM DNSSEC: unsigned URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of whois database: 2024-10-30T18:04:05Z