Kelleysseptictankandsewerservice.com
Are you human?
Domain Summary
What is the traffic rank for Kelleysseptictankandsewerservice.com?
• Kelleysseptictankandsewerservice.com ranks #8,383,586 globally on HypeStat.
What IP addresses does Kelleysseptictankandsewerservice.com resolve to?
• Kelleysseptictankandsewerservice.com resolves to the IP addresses 205.147.88.159.
Where are Kelleysseptictankandsewerservice.com servers located in?
• Kelleysseptictankandsewerservice.com has servers located in Ashburn, Virginia, 20147, United States.
kelleysseptictankandsewerservice.com Profile

kelleysseptictankandsewerservice.com Traffic Analysis
Kelleysseptictankandsewerservice.com is ranked #8,383,586 in the world.Daily Visitors n/a
Monthly Visits n/a
Pages per Visit n/a
Visit duration n/a
Bounce Rate n/a
Is this your site?Verify your site's metrics.
- Daily Unique Visitors:
- n/a
- Monthly Visits:
- n/a
- Pages per Visit:
- n/a
- Daily Pageviews:
- n/a
- Avg. visit duration:
- n/a
- Bounce rate:
- n/a
- Global Reach:
- n/a
- HypeRank:
- 8,383,586
- SEMrush Rank:
- 6,929,612
- SimilarWeb Rank:
- 18,766,020
Total Visits Last 3 Months
654
JUL
0
AUG
0
SEP
Backlinks Report ▼
Kelleysseptictankandsewerservice.com has a total of 14 backlinks from 12 referring domains and most of them comes from United States.- Total Backlinks:
- 14
- Follow Links:
- n/a
- Nofollow Links:
- n/a
- Referring Domains:
- 12
- Referring IPs:
- 12
- Authority Domain Score:
- 6
Backlinks by country
- Country
- Domains
- United States 2
Backlinks by TLDs
- TLD Distribution
- Domains
- .com
- 7
- .dev
- 2
- .co
- 1
- .edu
- 0
- .gov
- 0
Last update was 284 days ago
This can take up to 60 seconds. Please wait...
This can take up to 60 seconds. Please wait...
*HypeStat.com is not promoting or affiliated with kelleysseptictankandsewerservice.com in any way. Only publicly available statistics data are displayed.
▼
SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.- Domain:
- kelleysseptictankandsewerservice.com
- Rank:
(Rank based on keywords, cost and organic traffic) - 6,929,612
- Organic Keywords:
(Number of keywords in top 20 Google SERP) - 57
- Organic Traffic:
(Number of visitors coming from top 20 search results) - 15
- Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords) - $108.00
Ad Experience Report ▼
Summary of the ad experience rating of a website for a specific platform.Mobile summary
- Root domain:
- kelleysseptictankandsewerservice.com
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Desktop summary
- Root domain:
- kelleysseptictankandsewerservice.com
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Abusive Experience Report ▼
Summary of the abusive experience rating of a website.- Root domain:
- kelleysseptictankandsewerservice.com
- Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.) - Off
- Status:
(The status of the site reviewed for the abusive experiences.) - Not reviewed
Where is kelleysseptictankandsewerservice.com hosted? ▼
Kelleysseptictankandsewerservice.com may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.- Server IP:
- 205.147.88.159
- ASN:
- AS31898
- ISP:
- Oracle Corporation
- Server Location:
- Ashburn
Virginia, VA
20147
United States, US
Other sites hosted on 205.147.88.159
How fast does kelleysseptictankandsewerservice.com load? ▼
The average loading time of kelleysseptictankandsewerservice.com is 221 ms.- Average Load Time:
- 221 ms
Does kelleysseptictankandsewerservice.com use compression? ▼
Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on kelleysseptictankandsewerservice.com are reduced by 31%.
kelleysseptictankandsewerservice.com use gzip compression.
Original size: 9.06 KB
Compressed size: 6.24 KB
File reduced by: 2.82 KB (31%)
Compressed size: 6.24 KB
File reduced by: 2.82 KB (31%)
Google Safe Browsing ▼
Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.SSL Checker - SSL Certificate Verify ▼
An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. kelleysseptictankandsewerservice.com supports HTTPS. kelleysseptictankandsewerservice.com supports HTTPS
Verifying SSL Support. Please wait...
Common Name: www.kelleysseptictankandsewerservice.com
Organization:
Location:
Issuer: R11
Valid from: Sep 14 00:14:18 2024 GMT
Valid until: Dec 13 00:14:17 2024 GMT
Authority: CA:FALSE
Keysize: 4096 Bits
Organization:
Location:
Issuer: R11
Valid from: Sep 14 00:14:18 2024 GMT
Valid until: Dec 13 00:14:17 2024 GMT
Authority: CA:FALSE
Keysize: 4096 Bits
Common Name: R11
Organization: Let's Encrypt
Location: US
Issuer: ISRG Root X1
Valid from: Mar 13 00:00:00 2024 GMT
Valid until: Mar 12 23:59:59 2027 GMT
Authority: CA:TRUE
Keysize: 2048 Bits
Organization: Let's Encrypt
Location: US
Issuer: ISRG Root X1
Valid from: Mar 13 00:00:00 2024 GMT
Valid until: Mar 12 23:59:59 2027 GMT
Authority: CA:TRUE
Keysize: 2048 Bits
Verify HTTP/2 Support ▼
HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency. kelleysseptictankandsewerservice.com does not support HTTP/2
Verifying HTTP/2.0 Support. Please wait...
Http Header ▼
HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.Content-Type: text/html
Connection: keep-alive
Content-Length: 157
Server: ZENEDGE
Location: https://www.kelleysseptictankandsewerservice.com/
Date: Wed, 30 Oct 2024 15:06:32 GMT
X-Zen-Fury: 746365ef2f03504fe237ead47f951b1b7814b13e
X-Cdn: Served-By-Zenedge
HTTP/1.1 200 OK
Date: Wed, 30 Oct 2024 15:06:32 GMT
Content-Type: text/html
Transfer-Encoding: chunked
Connection: keep-alive
Cache-Control: no-store
Cache-Control: no-cache, no-store, must-revalidate
Cache-Control: max-age=0
X-Zen-Fury: f64c5e682ee31b428a0ed7a5bf7d1a7f10e349c3
Server: ZENEDGE
X-Cdn: Served-By-Zenedge
Content-Encoding: gzip
DNS Lookup ▼
DNS entries (Domain Name System) are a critical component of the Internet infrastructure. They act as directories that translate human-readable domain names (such as example.com) to machine-readable IP addresses. DNS records are stored on DNS servers and help forward internet traffic efficiently.Type | Ip | Target/Txt | TTL |
SOA | 300 | ||
Mname | ns1.systemdns.com | ||
Rname | hostmaster.systemdns.com | ||
Serial Number | 1711003711 | ||
Refresh | 10800 | ||
Retry | 3600 | ||
Expire | 1209600 | ||
Minimum TTL | 3600 | ||
MX | 300 | ||
TXT | 300 | ||
A | 205.147.88.159 | 250 | |
NS | 300 | ||
NS | 300 | ||
NS | 300 |
Whois Lookup ▼
Domain WHOIS is a public database that provides information about domain names, including registered owners, contact information, domain registrars, registration and expiration dates, name servers, and other relevant information. Domain registration for this website began on August 4, 2020 and will expire on August 4, 2025 if not renewed. This website is now assigned through the registrar Tucows Domains Inc.. The WHOIS data for this website's domain was last updated on July 6, 2024.- Domain Created:
- 2020-08-04
- Domain Expires:
- 2025-08-04
- Domain Updated:
- 2024-07-06
- Domain Age:
- 5 years 7 days
- Domain Registrar:
- Tucows Domains Inc.
- WhoIs:
Domain Name: KELLEYSSEPTICTANKANDSEWERSERVICE.COM Registry Domain ID: 2550891903_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.tucows.com Registrar URL: http://www.tucows.com Updated Date: 2024-07-06T05:19:01Z Creation Date: 2020-08-04T20:42:54Z Registry Expiry Date: 2025-08-04T20:42:54Z Registrar: Tucows Domains Inc. Registrar IANA ID: 69 Registrar Abuse Contact Email:Registrar Abuse Contact Phone: +1.4165350123 Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited Name Server: NS1.SYSTEMDNS.COM Name Server: NS2.SYSTEMDNS.COM Name Server: NS3.SYSTEMDNS.COM DNSSEC: unsigned URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of whois database: 2024-10-30T15:07:01Z