kaveethsamarawickramaliyanage.online Kaveethsamarawickramaliyanage.online

   

Domain Summary

What is the traffic rank for Kaveethsamarawickramaliyanage.online?

• Kaveethsamarawickramaliyanage.online ranks #14,082,910 globally on HypeStat.

What IP addresses does Kaveethsamarawickramaliyanage.online resolve to?

• Kaveethsamarawickramaliyanage.online resolves to the IP addresses 198.54.125.59.

Where are Kaveethsamarawickramaliyanage.online servers located in?

• Kaveethsamarawickramaliyanage.online has servers located in United States.

kaveethsamarawickramaliyanage.online Profile

What technologies does kaveethsamarawickramaliyanage.online use?

These are the technologies used at kaveethsamarawickramaliyanage.online. kaveethsamarawickramaliyanage.online has a total of 1 technologies installed in 1 different categories.

kaveethsamarawickramaliyanage.online Traffic Analysis

Kaveethsamarawickramaliyanage.online is ranked #14,082,910 in the world.
Daily Visitors n/a
Monthly Visits n/a
Pages per Visit n/a
Visit duration n/a
Bounce Rate n/a
Is this your site?Verify your site's metrics.
Daily Unique Visitors:
 n/a
Monthly Visits:
n/a
Pages per Visit:
n/a
Daily Pageviews:
n/a
Avg. visit duration:
n/a
Bounce rate:
n/a
Global Reach:
 n/a
HypeRank:
14,082,910
*All traffic values are estimates only.
Last update was 815 days ago
     
This can take up to 60 seconds. Please wait...

*HypeStat.com is not promoting or affiliated with kaveethsamarawickramaliyanage.online in any way. Only publicly available statistics data are displayed.

 

SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.
SemRushSemRush
Domain:
  kaveethsamarawickramaliyanage.online
Rank:
(Rank based on keywords, cost and organic traffic)
  n/a
Organic Keywords:
(Number of keywords in top 20 Google SERP)
  0
Organic Traffic:
(Number of visitors coming from top 20 search results)
  0
Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords)
  $0.00

Ad Experience Report

Summary of the ad experience rating of a website for a specific platform.

Mobile summary

Root domain:
kaveethsamarawickramaliyanage.online
Ad filtering:
(Chrome is not filtering ads on your site.)
Off
Status:
(The status of the site that is reviewed for the Better Ads Standards.)
Not reviewed

Desktop summary

Root domain:
kaveethsamarawickramaliyanage.online
Ad filtering:
(Chrome is not filtering ads on your site.)
Off
Status:
(The status of the site that is reviewed for the Better Ads Standards.)
Not reviewed

Abusive Experience Report

Summary of the abusive experience rating of a website.
Root domain:
kaveethsamarawickramaliyanage.online
Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.)
Off
Status:
(The status of the site reviewed for the abusive experiences.)
Not reviewed

Where is kaveethsamarawickramaliyanage.online hosted?

Kaveethsamarawickramaliyanage.online may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.
Server IP:
198.54.125.59
ASN:
AS22612 
ISP:
Namecheap, Inc. 
Server Location:

United States, US
 

Other sites hosted on 198.54.125.59

Does kaveethsamarawickramaliyanage.online use compression?

Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience.
kaveethsamarawickramaliyanage.online use gzip compression.
Original size: 163 B
Compressed size: 163 B
File reduced by: n/a

Google Safe Browsing

Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.
This site is not currently listed as suspicious

SSL Checker - SSL Certificate Verify

An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. kaveethsamarawickramaliyanage.online does not support HTTPS.
 kaveethsamarawickramaliyanage.online does not support HTTPS
     
Verifying SSL Support. Please wait...

Verify HTTP/2 Support

HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency.
 kaveethsamarawickramaliyanage.online does not support HTTP/2
     
Verifying HTTP/2.0 Support. Please wait...

Http Header

HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.
Server: nginx
Date: Fri, 21 Jan 2022 22:31:03 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Vary: Accept-Encoding
Set-Cookie: PHPSESSID=qjf418b8q1p0j524mjidfq9491; path=/
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Content-Encoding: gzip
keep-alive: timeout=5, max=100
content-type: text/html
last-modified: Wed, 17 Jun 2020 20:01:21 GMT
accept-ranges: bytes
content-length: 163
date: Fri, 21 Jan 2022 22:31:05 GMT
server: LiteSpeed
x-turbo-charged-by: LiteSpeed

DNS Lookup

DNS entries (Domain Name System) are a critical component of the Internet infrastructure. They act as directories that translate human-readable domain names (such as example.com) to machine-readable IP addresses. DNS records are stored on DNS servers and help forward internet traffic efficiently.
Type Ip Target/Txt TTL
HINFO 3600
A 198.54.125.59 1199
NS dns1.namecheaphosting.com 3599
NS dns2.namecheaphosting.com 3599