Idealstandard.at
Komplettbadlösungen | Alle Produkte fürs Bad | Ideal Standard
Domain Summary
What percent of global Internet users visit Idealstandard.at?
• 8.0E-7% of global Internet users visit Idealstandard.at
How many people visit Idealstandard.at each day?
• Idealstandard.at receives approximately 38 visitors and 40 page impressions per day.
Which countries does Idealstandard.at receive most of its visitors from?
• Idealstandard.at is mostly visited by people located in Germany,Austria,United States.
How much Idealstandard.at can earn?
• Idealstandard.at should earn about $0.08/day from advertising revenue.
What is Idealstandard.at estimated value?
• Estimated value of Idealstandard.at is $62.64.
What IP addresses does Idealstandard.at resolve to?
• Idealstandard.at resolves to the IP addresses 52.66.101.246.
Where are Idealstandard.at servers located in?
• Idealstandard.at has servers located in Mumbai, Maharashtra, 400070, India.
idealstandard.at Profile

What technologies does idealstandard.at use?
These are the technologies used at idealstandard.at. idealstandard.at has a total of 8 technologies installed in 8 different categories.idealstandard.at Traffic Analysis
This website is viewed by an estimated 38 visitors daily, generating a total of 40 pageviews. This equates to about 1.2K monthly visitors.Daily Visitors38
Monthly Visits1.2K
Pages per Visit1.06
Visit duration n/a
Bounce Rate43.72%
Is this your site?Verify your site's metrics.
- Daily Unique Visitors:
- 38
- Monthly Visits:
- 1,151
- Pages per Visit:
- 1.06
- Daily Pageviews:
- 40
- Avg. visit duration:
- n/a
- Bounce rate:
- 43.72%
- Global Reach:
- 8.0E-7%
- Monthly Visits (SEMrush):
- 1,266
- Monthly Unique Visitors (SEMrush):
- 496
- Monthly Visits (SimilarWeb):
- 1,154
- HypeRank:
- n/a
- SEMrush Rank:
- 20,278,607
- SimilarWeb Rank:
- 11,908,674
Traffic sources
- Direct:
- 100.00%
- Referral:
- 0%
- Search:
- 0%
- Social:
- 0%
- Paid:
- 0%
Desktop vs Mobile
- Desktop:
- 100.00%
- Mobile:
- 0%
Total Visits Last 3 Months
1K
NOV
1.2K
DEC
1.2K
JAN
Visitors by country
- Country
- Users%
- Germany 39.63%
- Austria 32.74%
- United States 14.57%
- Colombia 7.96%
- Indonesia 5.11%
Backlinks Report ▼
Idealstandard.at has a total of 34 backlinks from 28 referring domains and most of them comes from Romania.- Total Backlinks:
- 34
- Follow Links:
- n/a
- Nofollow Links:
- n/a
- Referring Domains:
- 28
- Referring IPs:
- 21
- Authority Domain Score:
- 14
Backlinks by country
- Country
- Domains
- Romania 8
- France 4
- Germany 3
- Netherlands 2
- United States 2
Backlinks by TLDs
- TLD Distribution
- Domains
- .com
- 9
- .nl
- 3
- .at
- 3
- .edu
- 0
- .gov
- 0
Last update was 182 days ago
This can take up to 60 seconds. Please wait...
This can take up to 60 seconds. Please wait...
*HypeStat.com is not promoting or affiliated with idealstandard.at in any way. Only publicly available statistics data are displayed.
Search Engine Indexes ▼
Search engine indexes are huge databases or collections of net pages that search engines like google like google and yahoo use to retrieve applicable facts while customers carry out searches. These indexes are created through search engines like google and yahoo through crawling and indexing net pages from throughout the internet.- Google Index:
- 3,430
▼
SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.- Domain:
- idealstandard.at
- Rank:
(Rank based on keywords, cost and organic traffic) - 20,278,607
- Organic Keywords:
(Number of keywords in top 20 Google SERP) - 4
- Organic Traffic:
(Number of visitors coming from top 20 search results) - 0
- Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords) - $0.00
Revenue report ▼
Google.com would generate approximately $0.1 per day if the source of income were advertisements, which equates to an estimated monthly revenue of $2.4 and annual gross revenue of approximately $29.2. Based on these figures, the site's net worth is estimated at around $62.6.How much would idealstandard.at make?
- Daily Revenue:
- $0.08
- Monthly Revenue:
- $2.40
- Yearly Revenue:
- $29.20
Daily earning by country
- CountryPageviewsEarning
- United States 6$0.03
- Austria 13$0.03
- Germany 16$0.02
- Colombia 3$0.00
- Indonesia 2$0.00
Loss of money due to Adblock?
- Daily Revenue Loss:
- $0.02
- Monthly Revenue Loss:
- $0.56
- Yearly Revenue Loss:
- $6.82
- Daily Pageviews Blocked:
- 10
- Monthly Pageviews Blocked:
- 315
- Yearly Pageviews Blocked:
- 3,829
Daily revenue loss by country
- CountryBlockedLost Money
- Austria 3$0.01
- Germany 5$0.01
- United States 1$0.01
- Colombia 0$0.00
- Indonesia 1$0.00
How much is idealstandard.at worth?
- Website Value:
- $62.6
Ad Experience Report ▼
Summary of the ad experience rating of a website for a specific platform.Mobile summary
- Root domain:
- idealstandard.at
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Desktop summary
- Root domain:
- idealstandard.at
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Abusive Experience Report ▼
Summary of the abusive experience rating of a website.- Root domain:
- idealstandard.at
- Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.) - Off
- Status:
(The status of the site reviewed for the abusive experiences.) - Not reviewed
Where is idealstandard.at hosted? ▼
Idealstandard.at may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.- Server IP:
- 52.66.101.246
- ASN:
- AS16509
- ISP:
- Amazon.com, Inc.
- Server Location:
- Mumbai
Maharashtra, MH
400070
India, IN
Other sites hosted on 52.66.101.246
How fast does idealstandard.at load? ▼
The average loading time of idealstandard.at is 1851 ms.- Average Load Time:
- 1851 ms
Does idealstandard.at use compression? ▼
Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on idealstandard.at are reduced by 85%.
idealstandard.at use gzip compression.
Original size: 180.65 KB
Compressed size: 26.96 KB
File reduced by: 153.69 KB (85%)
Compressed size: 26.96 KB
File reduced by: 153.69 KB (85%)
Google Safe Browsing ▼
Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.
This site is not currently listed as suspicious
MyWot.com Reputation Ratings
MyWOT (short for "My Web of Trust") is a web-based reputation and rating service that provides users with information about the trustworthiness and safety of websites. idealstandard.at has 60 Safety Reputations.- Status:
- UNKNOWN
- Safety Reputations:
- 60
- Safety Confidence:
- 2
SSL Checker - SSL Certificate Verify ▼
An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. idealstandard.at supports HTTPS. idealstandard.at supports HTTPS
Verifying SSL Support. Please wait...
Common Name: www.idealstandardinternational.com
Organization: Ideal Standard International NV
Location: Zaventem, BE
Issuer: Go Daddy Secure Certificate Authority - G2
Valid from: Apr 22 03:16:27 2024 GMT
Valid until: May 24 03:16:27 2025 GMT
Authority: CA:FALSE
Keysize: 2048 Bits
Organization: Ideal Standard International NV
Location: Zaventem, BE
Issuer: Go Daddy Secure Certificate Authority - G2
Valid from: Apr 22 03:16:27 2024 GMT
Valid until: May 24 03:16:27 2025 GMT
Authority: CA:FALSE
Keysize: 2048 Bits
Common Name: Go Daddy Secure Certificate Authority - G2
Organization: "GoDaddy.com, Inc.", OU = http://certs.godaddy.com/repository/
Location: Scottsdale, Arizona, US
Issuer: Go Daddy Root Certificate Authority - G2
Valid from: May 3 07:00:00 2011 GMT
Valid until: May 3 07:00:00 2031 GMT
Authority: CA:TRUE
Keysize: 2048 Bits
Organization: "GoDaddy.com, Inc.", OU = http://certs.godaddy.com/repository/
Location: Scottsdale, Arizona, US
Issuer: Go Daddy Root Certificate Authority - G2
Valid from: May 3 07:00:00 2011 GMT
Valid until: May 3 07:00:00 2031 GMT
Authority: CA:TRUE
Keysize: 2048 Bits
Common Name: Go Daddy Root Certificate Authority - G2
Organization: "GoDaddy.com, Inc."
Location: Scottsdale, Arizona, US
Issuer:
Valid from: Jan 1 07:00:00 2014 GMT
Valid until: May 30 07:00:00 2031 GMT
Authority: CA:TRUE
Keysize: 2048 Bits
Organization: "GoDaddy.com, Inc."
Location: Scottsdale, Arizona, US
Issuer:
Valid from: Jan 1 07:00:00 2014 GMT
Valid until: May 30 07:00:00 2031 GMT
Authority: CA:TRUE
Keysize: 2048 Bits
Common Name:
Organization: "The Go Daddy Group, Inc.", OU = Go Daddy Class 2 Certification Authori
Location: US
Issuer:
Valid from: Jun 29 17:06:20 2004 GMT
Valid until: Jun 29 17:06:20 2034 GMT
Authority: CA:TRUE
Keysize: 2048 Bits
Organization: "The Go Daddy Group, Inc.", OU = Go Daddy Class 2 Certification Authori
Location: US
Issuer:
Valid from: Jun 29 17:06:20 2004 GMT
Valid until: Jun 29 17:06:20 2034 GMT
Authority: CA:TRUE
Keysize: 2048 Bits
Verify HTTP/2 Support ▼
HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency. idealstandard.at supports HTTP/2
Verifying HTTP/2.0 Support. Please wait...
Http Header ▼
HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.Date: Mon, 10 Feb 2025 08:38:04 GMT
Server: Apache
Location: https://www.idealstandard.at/
Content-Length: 239
Content-Type: text/html; charset=iso-8859-1
HTTP/2 200
content-type: text/html; charset=utf-8
content-length: 27609
date: Mon, 10 Feb 2025 08:38:05 GMT
set-cookie: sess_map=utcxfsseeseszfasfcrxvqesvwqsrudsfqbdrtsryztvstruyvysfzfsabdvaweufbsztxwsfbtzqyxacqssdqrssewuavrbtayqwddafeyewcstffadsywsqqsqwqqdsywvcfcdudybcebtefwduexvyfdqqwsfqywvxxwuwtstdedq; Path=/; HttpOnly; Secure;
cache-control: no-cache, no-store
content-encoding: gzip
expires: -1
pragma: no-cache
vary: Accept-Encoding
strict-transport-security: max-age=31536000
x-frame-options: SAMEORIGIN
request-context: appId=cid-v1:7d163cd6-0c4f-4842-bfda-74c2aa006081
server-id: cd2
content-security-policy: upgrade-insecure-requests; frame-ancestors 'self';
x-content-type-options: nosniff
referrer-policy: same-origin
permissions-policy: self
x-xss-protection: 1; mode=block
set-cookie: role=Homeowner; path=/
set-cookie: ASP.NET_SessionId=nqllkd4auwo0nwjks15cm3ti; path=/; HttpOnly; SameSite=Lax
set-cookie: role=Homeowner; path=/
set-cookie: ASP.NET_SessionId=nqllkd4auwo0nwjks15cm3ti; path=/; HttpOnly; SameSite=Lax
set-cookie: SC_ANALYTICS_GLOBAL_COOKIE=20de689a1036488c82f4b8aa46a4481c|False; expires=Thu, 08-Feb-2035 08:38:04 GMT; path=/; HttpOnly
set-cookie: __RequestVerificationToken=z1idy98a0CR3hIZmALoMlxsZeqslAIx5AdtLC5ZSitOlr3qGO_7K_o3JM8dOnQwROcI0YzkpaORdvrjslMUfODlgaU01; path=/; HttpOnly
set-cookie: sxa_site=CD_DE; path=/
set-cookie: ARRAffinity=e5a50dd7c4f1ed1c45397fe19a758bf83d49c01fa1012cf0a677235929fc0103;Path=/;HttpOnly;Secure;Domain=www.idealstandard.at
set-cookie: ARRAffinitySameSite=e5a50dd7c4f1ed1c45397fe19a758bf83d49c01fa1012cf0a677235929fc0103;Path=/;HttpOnly;SameSite=None;Secure;Domain=www.idealstandard.at
x-mp-xae2: 4369
apptrana-request-id: 5940221c5c6155a058a56939814c786e
age: 0
accept-ranges: bytes
x-cache: MISS,v11ord1
x-tata-request-id: 43b6c1f7f7fd2b6ffafd24d9ec163c90
server: v/6.8.6/6.5.30/v11ord1-www
x-version: indus5UvPpRdyk0C_v5
x-tata-request-id: 43b6c1f7f7fd2b6ffafd24d9ec163c90
DNS Lookup ▼
DNS entries (Domain Name System) are a critical component of the Internet infrastructure. They act as directories that translate human-readable domain names (such as example.com) to machine-readable IP addresses. DNS records are stored on DNS servers and help forward internet traffic efficiently.Type | Ip | Target/Txt | TTL |
SOA | 3600 | ||
Mname | ns1214.ispapi.net | ||
Rname | hostmaster.idealstandard.at | ||
Serial Number | 2024041900 | ||
Refresh | 86400 | ||
Retry | 7200 | ||
Expire | 3600000 | ||
Minimum TTL | 172800 | ||
TXT | 3600 | ||
TXT | 3600 | ||
TXT | 3600 | ||
TXT | 3600 | ||
TXT | 3600 | ||
TXT | 3600 | ||
A | 52.66.101.246 | 513 | |
NS | 3600 | ||
NS | 3600 | ||
NS | 3600 |
Whois Lookup ▼
Domain WHOIS is a public database that provides information about domain names, including registered owners, contact information, domain registrars, registration and expiration dates, name servers, and other relevant information.- Domain Updated:
- 2025-01-14
- Domain Registrar:
- 1API GmbH ( https://nic.at/registrar/578 )
- Domain Owner:
- Ideal Standard International
- WhoIs:
% Copyright (c)2025 by NIC.AT (1) % % Restricted rights. % % Except for agreed Internet operational purposes, no part of this % information may be reproduced, stored in a retrieval system, or % transmitted, in any form or by any means, electronic, mechanical, % recording, or otherwise, without prior permission of NIC.AT on behalf % of itself and/or the copyright holders. Any use of this material to % target advertising or similar activities is explicitly forbidden and % can be prosecuted. % % It is furthermore strictly forbidden to use the Whois-Database in such % a way that jeopardizes or could jeopardize the stability of the % technical systems of NIC.AT under any circumstances. In particular, % this includes any misuse of the Whois-Database and any use of the % Whois-Database which disturbs its operation. % % Should the user violate these points, NIC.AT reserves the right to % deactivate the Whois-Database entirely or partly for the user. % Moreover, the user shall be held liable for any and all damage % arising from a violation of these points. domain: idealstandard.at registrar: 1API GmbH ( https://nic.at/registrar/578 ) registrant: ISI14286178-NICAT tech-c: ISI14286178-NICAT nserver: ns1214.ispapi.net nserver: ns2175.ispapi.net nserver: ns3162.ispapi.net changed: 20250114 13:11:46 source: AT-DOM personname: Webmaster IdealStandard organization: Ideal Standard International street address: Corporate Village - Gent Building postal code: 1935 city: Zaventem country: Belgium phone: +32441482496361 e-mail:nic-hdl: ISI14286178-NICAT changed: 20250114 13:11:46 source: AT-DOM