Dynamicfleetservicesandrepair.com
Home - Dynamic Fleet Services and RepairDomain Summary
What is the traffic rank for Dynamicfleetservicesandrepair.com?
• Dynamicfleetservicesandrepair.com ranks #8,456,489 globally on HypeStat.
What IP addresses does Dynamicfleetservicesandrepair.com resolve to?
• Dynamicfleetservicesandrepair.com resolves to the IP addresses 108.178.44.242.
Where are Dynamicfleetservicesandrepair.com servers located in?
• Dynamicfleetservicesandrepair.com has servers located in United States.
dynamicfleetservicesandrepair.com Profile
Title:Home - Dynamic Fleet Services and Repair
What technologies does dynamicfleetservicesandrepair.com use?
These are the technologies used at dynamicfleetservicesandrepair.com. dynamicfleetservicesandrepair.com has a total of 14 technologies installed in 14 different categories.dynamicfleetservicesandrepair.com Traffic Analysis
Dynamicfleetservicesandrepair.com is ranked #8,456,489 in the world.Daily Visitors n/a
Monthly Visits n/a
Pages per Visit n/a
Visit duration n/a
Bounce Rate n/a
Is this your site?Verify your site's metrics.
- Daily Unique Visitors:
- n/a
- Monthly Visits:
- n/a
- Pages per Visit:
- n/a
- Daily Pageviews:
- n/a
- Avg. visit duration:
- n/a
- Bounce rate:
- n/a
- Global Reach:
- n/a
- HypeRank:
- 8,456,489
- SEMrush Rank:
- 4,767,376
Backlinks Report ▼
Dynamicfleetservicesandrepair.com has a total of 56 backlinks from 34 referring domains and most of them comes from United States.- Total Backlinks:
- 56
- Follow Links:
- n/a
- Nofollow Links:
- n/a
- Referring Domains:
- 34
- Referring IPs:
- 35
- Authority Domain Score:
- 8
Backlinks by country
- Country
- Domains
- United States 9
- France 3
- Germany 3
- Romania 2
- Italy 1
Backlinks by TLDs
- TLD Distribution
- Domains
- .com
- 19
- .de
- 2
- .ar
- 2
- .edu
- 0
- .gov
- 0
Last update was 54 days ago
This can take up to 60 seconds. Please wait...
This can take up to 60 seconds. Please wait...
*HypeStat.com is not promoting or affiliated with dynamicfleetservicesandrepair.com in any way. Only publicly available statistics data are displayed.
▼
SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.- Domain:
- dynamicfleetservicesandrepair.com
- Rank:
(Rank based on keywords, cost and organic traffic) - 4,767,376
- Organic Keywords:
(Number of keywords in top 20 Google SERP) - 23
- Organic Traffic:
(Number of visitors coming from top 20 search results) - 51
- Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords) - $303.00
Ad Experience Report ▼
Summary of the ad experience rating of a website for a specific platform.Mobile summary
- Root domain:
- dynamicfleetservicesandrepair.com
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Desktop summary
- Root domain:
- dynamicfleetservicesandrepair.com
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Abusive Experience Report ▼
Summary of the abusive experience rating of a website.- Root domain:
- dynamicfleetservicesandrepair.com
- Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.) - Off
- Status:
(The status of the site reviewed for the abusive experiences.) - Not reviewed
Where is dynamicfleetservicesandrepair.com hosted? ▼
Dynamicfleetservicesandrepair.com may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.- Server IP:
- 108.178.44.242
- ASN:
- AS32475
- ISP:
- SingleHop, Inc.
- Server Location:
United States, US
Other sites hosted on 108.178.44.242
How fast does dynamicfleetservicesandrepair.com load? ▼
The average loading time of dynamicfleetservicesandrepair.com is 22 ms.- Average Load Time:
- 22 ms
Does dynamicfleetservicesandrepair.com use compression? ▼
Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on dynamicfleetservicesandrepair.com are reduced by 84%.
dynamicfleetservicesandrepair.com use br compression.
Original size: 214.58 KB
Compressed size: 32.92 KB
File reduced by: 181.66 KB (84%)
Compressed size: 32.92 KB
File reduced by: 181.66 KB (84%)
Google Safe Browsing ▼
Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.SSL Checker - SSL Certificate Verify ▼
An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. dynamicfleetservicesandrepair.com supports HTTPS. dynamicfleetservicesandrepair.com supports HTTPS
Verifying SSL Support. Please wait...
Common Name: dynamicfleetservicesandrepair.com
Organization:
Location:
Issuer: R11
Valid from: Oct 7 00:54:57 2024 GMT
Valid until: Jan 5 00:54:56 2025 GMT
Authority: CA:FALSE
Keysize: 2048 Bits
Organization:
Location:
Issuer: R11
Valid from: Oct 7 00:54:57 2024 GMT
Valid until: Jan 5 00:54:56 2025 GMT
Authority: CA:FALSE
Keysize: 2048 Bits
Common Name: R11
Organization: Let's Encrypt
Location: US
Issuer: ISRG Root X1
Valid from: Mar 13 00:00:00 2024 GMT
Valid until: Mar 12 23:59:59 2027 GMT
Authority: CA:TRUE
Keysize: 2048 Bits
Organization: Let's Encrypt
Location: US
Issuer: ISRG Root X1
Valid from: Mar 13 00:00:00 2024 GMT
Valid until: Mar 12 23:59:59 2027 GMT
Authority: CA:TRUE
Keysize: 2048 Bits
Verify HTTP/2 Support ▼
HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency. dynamicfleetservicesandrepair.com supports HTTP/2
Verifying HTTP/2.0 Support. Please wait...
Http Header ▼
HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.x-powered-by: PHP/7.4.33
content-type: text/html; charset=UTF-8
link: <https://dynamicfleetservicesandrepair.com/wp-json/>; rel="https://api.w.org/"
link: <https://dynamicfleetservicesandrepair.com/wp-json/wp/v2/pages/51>; rel="alternate"; title="JSON"; type="application/json"
link: <https://dynamicfleetservicesandrepair.com/>; rel=shortlink
etag: "15-1730796362;br"
x-litespeed-cache: hit
content-encoding: br
vary: Accept-Encoding
content-length: 33708
date: Sat, 09 Nov 2024 13:48:32 GMT
strict-transport-security: max-age=31536000; includeSubDomains; preload
x-frame-options: SAMEORIGIN
x-content-type-options: nosniff
alt-svc: h3=":443"; ma=2592000, h3-29=":443"; ma=2592000, h3-Q050=":443"; ma=2592000, h3-Q046=":443"; ma=2592000, h3-Q043=":443"; ma=2592000, quic=":443"; ma=2592000; v="43,46"
DNS Lookup ▼
DNS entries (Domain Name System) are a critical component of the Internet infrastructure. They act as directories that translate human-readable domain names (such as example.com) to machine-readable IP addresses. DNS records are stored on DNS servers and help forward internet traffic efficiently.Type | Ip | Target/Txt | TTL |
SOA | 86400 | ||
Mname | ns1.greengeeks.net | ||
Rname | rmallory.iordesign.com | ||
Serial Number | 2024100701 | ||
Refresh | 3600 | ||
Retry | 1800 | ||
Expire | 1209600 | ||
Minimum TTL | 86400 | ||
MX | 14400 | ||
TXT | 14400 | ||
A | 108.178.44.242 | 14339 | |
NS | 86400 | ||
NS | 86400 |
Whois Lookup ▼
Domain WHOIS is a public database that provides information about domain names, including registered owners, contact information, domain registrars, registration and expiration dates, name servers, and other relevant information. Domain registration for this website began on June 8, 2021 and will expire on June 8, 2025 if not renewed. This website is now assigned through the registrar ENOM, INC.. The WHOIS data for this website's domain was last updated on June 7, 2024.- Domain Created:
- 2021-06-08
- Domain Expires:
- 2025-06-08
- Domain Updated:
- 2024-06-07
- Domain Age:
- 3 years 6 months 24 days
- Domain Registrar:
- ENOM, INC.
- Domain Owner:
- REDACTED FOR PRIVACY
- WhoIs:
Domain Name: dynamicfleetservicesandrepair.com Registry Domain ID: 2618137438_DOMAIN_COM-VRSN Registrar WHOIS Server: WHOIS.ENOM.COM Registrar URL: WWW.ENOMDOMAINS.COM Updated Date: 2024-06-07T08:10:42.00Z Creation Date: 2021-06-08T17:26:00.00Z Registrar Registration Expiration Date: 2025-06-08T17:26:52.00Z Registrar: ENOM, INC. Registrar IANA ID: 48 Domain Status: clientTransferProhibited https://www.icann.org/epp#clientTransferProhibited Registrant Name: REDACTED FOR PRIVACY Registrant Organization: REDACTED FOR PRIVACY Registrant Street: REDACTED FOR PRIVACY Registrant Street: Registrant City: REDACTED FOR PRIVACY Registrant State/Province: OR Registrant Postal Code: REDACTED FOR PRIVACY Registrant Country: US Registrant Phone: REDACTED FOR PRIVACY Registrant Phone Ext: Registrant Fax: REDACTED FOR PRIVACY Registrant Email: https://tieredaccess.com/contact/1166b198-52b6-4f08-b635-32dfbd0c6023 Admin Name: REDACTED FOR PRIVACY Admin Organization: REDACTED FOR PRIVACY Admin Street: REDACTED FOR PRIVACY Admin Street: Admin City: REDACTED FOR PRIVACY Admin State/Province: REDACTED FOR PRIVACY Admin Postal Code: REDACTED FOR PRIVACY Admin Country: REDACTED FOR PRIVACY Admin Phone: REDACTED FOR PRIVACY Admin Phone Ext: Admin Fax: REDACTED FOR PRIVACY Admin Email: REDACTED FOR PRIVACY Tech Name: REDACTED FOR PRIVACY Tech Organization: REDACTED FOR PRIVACY Tech Street: REDACTED FOR PRIVACY Tech Street: Tech City: REDACTED FOR PRIVACY Tech State/Province: REDACTED FOR PRIVACY Tech Postal Code: REDACTED FOR PRIVACY Tech Country: REDACTED FOR PRIVACY Tech Phone: REDACTED FOR PRIVACY Tech Phone Ext: Tech Fax: REDACTED FOR PRIVACY Tech Email: REDACTED FOR PRIVACY Name Server: NS1.GREENGEEKS.NET Name Server: NS2.GREENGEEKS.NET DNSSEC: unsigned Registrar Abuse Contact Email: Registrar Abuse Contact Phone: +1.4259744689 URL of the ICANN WHOIS Data Problem Reporting System: HTTPS://ICANN.ORG/WICF >>> Last update of WHOIS database: 2024-11-09T13:49:32.00Z