cvscaremarkspecialtypharmacy.net Cvscaremarkspecialtypharmacy.net

   
404 Error

Domain Summary

What is the traffic rank for Cvscaremarkspecialtypharmacy.net?

• Cvscaremarkspecialtypharmacy.net ranks #7,113,544 globally on HypeStat.

What IP addresses does Cvscaremarkspecialtypharmacy.net resolve to?

• Cvscaremarkspecialtypharmacy.net resolves to the IP addresses 50.87.144.197.

Where are Cvscaremarkspecialtypharmacy.net servers located in?

• Cvscaremarkspecialtypharmacy.net has servers located in United States.

cvscaremarkspecialtypharmacy.net Profile

Title:404 Error

What technologies does cvscaremarkspecialtypharmacy.net use?

These are the technologies used at cvscaremarkspecialtypharmacy.net. cvscaremarkspecialtypharmacy.net has a total of 1 technologies installed in 1 different categories.

cvscaremarkspecialtypharmacy.net Traffic Analysis

Cvscaremarkspecialtypharmacy.net is ranked #7,113,544 in the world.
Daily Visitors n/a
Monthly Visits n/a
Pages per Visit n/a
Visit duration n/a
Bounce Rate n/a
Is this your site?Verify your site's metrics.
Daily Unique Visitors:
 n/a
Monthly Visits:
n/a
Pages per Visit:
n/a
Daily Pageviews:
n/a
Avg. visit duration:
n/a
Bounce rate:
n/a
Global Reach:
 n/a
HypeRank:
7,113,544
*All traffic values are estimates only.
Last update was 156 days ago
     
This can take up to 60 seconds. Please wait...

*HypeStat.com is not promoting or affiliated with cvscaremarkspecialtypharmacy.net in any way. Only publicly available statistics data are displayed.

 

SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.
SemRushSemRush
Domain:
  cvscaremarkspecialtypharmacy.net
Rank:
(Rank based on keywords, cost and organic traffic)
  n/a
Organic Keywords:
(Number of keywords in top 20 Google SERP)
  0
Organic Traffic:
(Number of visitors coming from top 20 search results)
  0
Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords)
  $0.00

Ad Experience Report

Summary of the ad experience rating of a website for a specific platform.

Mobile summary

Root domain:
cvscaremarkspecialtypharmacy.net
Ad filtering:
(Chrome is not filtering ads on your site.)
Off
Status:
(The status of the site that is reviewed for the Better Ads Standards.)
Not reviewed

Desktop summary

Root domain:
cvscaremarkspecialtypharmacy.net
Ad filtering:
(Chrome is not filtering ads on your site.)
Off
Status:
(The status of the site that is reviewed for the Better Ads Standards.)
Not reviewed

Abusive Experience Report

Summary of the abusive experience rating of a website.
Root domain:
cvscaremarkspecialtypharmacy.net
Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.)
Off
Status:
(The status of the site reviewed for the abusive experiences.)
Not reviewed

Where is cvscaremarkspecialtypharmacy.net hosted?

Cvscaremarkspecialtypharmacy.net may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.
Server IP:
50.87.144.197
ASN:
AS46606 
ISP:
Unified Layer 
Server Location:

United States, US
 

Other sites hosted on 50.87.144.197

There are no other sites hosted on this IP

How fast does cvscaremarkspecialtypharmacy.net load?

The average loading time of cvscaremarkspecialtypharmacy.net is 252 ms. The Desktop speed index is 100 and mobile speed index is 100.
Average Load Time:
252 ms

Page Speed (Google PageSpeed Insights) - Desktop

100
0-49 50-89 90-100 i

Field Data

Over the last 30 days, the field data shows that this page has a speed compared to other pages in the Chrome User Experience Report.We are showing the 90th percentile of FCP and the 95th percentile of FID.

First Contentful Paint (FCP)0 0% of loads for this page have a fast (<0s) First Contentful Paint (FCP) 0% 0% of loads for this page have an average (0s ~ 0s) First Contentful Paint (FCP) 0% 0% of loads for this page have a slow (>0s) First Contentful Paint (FCP) 0%
First Input Delay (FID)0 0% of loads for this page have a fast (<0ms) First Input Delay (FID) 0% 0% of loads for this page have an average (0ms ~ 0ms) First Input Delay (FID) 0% 0% of loads for this page have a slow (>0ms) First Input Delay (FID) 0%

Origin Data

All pages served from this origin have an speed compared to other pages in the Chrome User Experience Report. over the last 30 days.To view suggestions tailored to each page, analyze individual page URLs.

First Contentful Paint (FCP)0 0% of loads for this page have a fast (<0s) First Contentful Paint (FCP) 0% 0% of loads for this page have an average (0s ~ 0s) First Contentful Paint (FCP) 0% 0% of loads for this page have a slow (>0s) First Contentful Paint (FCP) 0%
First Input Delay (FID)0 0% of loads for this page have a fast (<0ms) First Input Delay (FID) 0% 0% of loads for this page have an average 0ms ~ 0ms) First Input Delay (FID) 0% 0% of loads for this page have a slow (>0ms) First Input Delay (FID) 0%

Lab Data

Minimize third-party usage  
Third-party code can significantly impact load performance. Limit the number of redundant third-party providers and try to load third-party code after your page has primarily finished loading. Learn how to minimize third-party impact
Has a `<meta name="viewport">` tag with `width` or `initial-scale`  
A `<meta name="viewport">` not only optimizes your app for mobile screen sizes, but also prevents . a 300 millisecond delay to user input Learn more about using the viewport meta tag
Performance budget  
Keep the quantity and size of network requests under the targets set by the provided performance budget. Learn more about performance budgets
Time to Interactive 0.4 s
Time to Interactive is the amount of time it takes for the page to become fully interactive. Learn more about the Time to Interactive metric
Speed Index 0.5 s
Speed Index shows how quickly the contents of a page are visibly populated. Learn more about the Speed Index metric
First Meaningful Paint 0.4 s
First Meaningful Paint measures when the primary content of a page is visible. Learn more about the First Meaningful Paint metric
First Contentful Paint 0.4 s
First Contentful Paint marks the time at which the first text or image is painted. Learn more about the First Contentful Paint metric
Total Blocking Time 0 ms
Sum of all time periods between FCP and Time to Interactive, when task length exceeded 50ms, expressed in milliseconds. Learn more about the Total Blocking Time metric
Timing budget  
Set a timing budget to help you keep an eye on the performance of your site. Performant sites load fast and respond to user input events quickly. Learn more about performance budgets
Largest Contentful Paint image was not lazily loaded  
Above-the-fold images that are lazily loaded render later in the page lifecycle, which can delay the largest contentful paint. Learn more about optimal lazy loading
Largest Contentful Paint 0.4 s
Largest Contentful Paint marks the time at which the largest text or image is painted. Learn more about the Largest Contentful Paint metric
Lazy load third-party resources with facades  
Some third-party embeds can be lazy loaded. Consider replacing them with a facade until they are required. Learn how to defer third-parties with a facade
Preload Largest Contentful Paint image  
If the LCP element is dynamically added to the page, you should preload the image in order to improve LCP. Learn more about preloading LCP elements
Max Potential First Input Delay 20 ms
The maximum potential First Input Delay that your users could experience is the duration of the longest task. Learn more about the Maximum Potential First Input Delay metric

Page Speed (Google PageSpeed Insights) - Mobile

100
0-49 50-89 90-100 i

Field Data

Over the last 30 days, the field data shows that this page has a speed compared to other pages in the Chrome User Experience Report.We are showing the 90th percentile of FCP and the 95th percentile of FID.

First Contentful Paint (FCP)0 0% of loads for this page have a fast (<0s) First Contentful Paint (FCP) 0% 0% of loads for this page have an average (0s ~ 0s) First Contentful Paint (FCP) 0% 0% of loads for this page have a slow (>0s) First Contentful Paint (FCP) 0%
First Input Delay (FID)0 0% of loads for this page have a fast (<0ms) First Input Delay (FID) 0% 0% of loads for this page have an average (0ms ~ 0ms) First Input Delay (FID) 0% 0% of loads for this page have a slow (>0ms) First Input Delay (FID) 0%

Origin Data

All pages served from this origin have an speed compared to other pages in the Chrome User Experience Report. over the last 30 days.To view suggestions tailored to each page, analyze individual page URLs.

First Contentful Paint (FCP)0 0% of loads for this page have a fast (<0s) First Contentful Paint (FCP) 0% 0% of loads for this page have an average (0s ~ 0s) First Contentful Paint (FCP) 0% 0% of loads for this page have a slow (>0s) First Contentful Paint (FCP) 0%
First Input Delay (FID)0 0% of loads for this page have a fast (<0ms) First Input Delay (FID) 0% 0% of loads for this page have an average 0ms ~ 0ms) First Input Delay (FID) 0% 0% of loads for this page have a slow (>0ms) First Input Delay (FID) 0%

Lab Data

Lazy load third-party resources with facades  
Some third-party embeds can be lazy loaded. Consider replacing them with a facade until they are required. Learn how to defer third-parties with a facade
Minimize third-party usage  
Third-party code can significantly impact load performance. Limit the number of redundant third-party providers and try to load third-party code after your page has primarily finished loading. Learn how to minimize third-party impact
Timing budget  
Set a timing budget to help you keep an eye on the performance of your site. Performant sites load fast and respond to user input events quickly. Learn more about performance budgets
Total Blocking Time 0 ms
Sum of all time periods between FCP and Time to Interactive, when task length exceeded 50ms, expressed in milliseconds. Learn more about the Total Blocking Time metric
Largest Contentful Paint image was not lazily loaded  
Above-the-fold images that are lazily loaded render later in the page lifecycle, which can delay the largest contentful paint. Learn more about optimal lazy loading
First Contentful Paint 1.0 s
First Contentful Paint marks the time at which the first text or image is painted. Learn more about the First Contentful Paint metric
Speed Index 1.0 s
Speed Index shows how quickly the contents of a page are visibly populated. Learn more about the Speed Index metric
Max Potential First Input Delay 40 ms
The maximum potential First Input Delay that your users could experience is the duration of the longest task. Learn more about the Maximum Potential First Input Delay metric
Time to Interactive 1.0 s
Time to Interactive is the amount of time it takes for the page to become fully interactive. Learn more about the Time to Interactive metric
Performance budget  
Keep the quantity and size of network requests under the targets set by the provided performance budget. Learn more about performance budgets
First Meaningful Paint 1.0 s
First Meaningful Paint measures when the primary content of a page is visible. Learn more about the First Meaningful Paint metric
Largest Contentful Paint 1.0 s
Largest Contentful Paint marks the time at which the largest text or image is painted. Learn more about the Largest Contentful Paint metric
Preload Largest Contentful Paint image  
If the LCP element is dynamically added to the page, you should preload the image in order to improve LCP. Learn more about preloading LCP elements
Has a `<meta name="viewport">` tag with `width` or `initial-scale`  
A `<meta name="viewport">` not only optimizes your app for mobile screen sizes, but also prevents . a 300 millisecond delay to user input Learn more about using the viewport meta tag

Does cvscaremarkspecialtypharmacy.net use compression?

Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on cvscaremarkspecialtypharmacy.net are reduced by 38%.
cvscaremarkspecialtypharmacy.net use gzip compression.
Original size: 746 B
Compressed size: 462 B
File reduced by: 284 B (38%)

Google Safe Browsing

Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.
This site is not currently listed as suspicious

MyWot.com Reputation Ratings

MyWOT (short for "My Web of Trust") is a web-based reputation and rating service that provides users with information about the trustworthiness and safety of websites.
Status:
  NOT_SAFE

SSL Checker - SSL Certificate Verify

An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. cvscaremarkspecialtypharmacy.net supports HTTPS.
 cvscaremarkspecialtypharmacy.net supports HTTPS
     
Verifying SSL Support. Please wait...
Common Name: *.hostgator.com
Organization:
Location:
Issuer: Sectigo RSA Domain Validation Secure Server CA
Valid from: Aug 30 00:00:00 2023 GMT
Valid until: Sep 29 23:59:59 2024 GMT
Authority: CA:FALSE
Keysize: 2048 Bits
Common Name: Sectigo RSA Domain Validation Secure Server CA
Organization: Sectigo Limited
Location: Salford, Greater Manchester, GB
Issuer: USERTrust RSA Certification Authority
Valid from: Nov 2 00:00:00 2018 GMT
Valid until: Dec 31 23:59:59 2030 GMT
Authority: CA:TRUE
Keysize: 2048 Bits
Common Name: USERTrust RSA Certification Authority
Organization: The USERTRUST Network
Location: Jersey City, New Jersey, US
Issuer: AAA Certificate Services
Valid from: Mar 12 00:00:00 2019 GMT
Valid until: Dec 31 23:59:59 2028 GMT
Authority: CA:TRUE
Keysize: 4096 Bits

Verify HTTP/2 Support

HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency.
 cvscaremarkspecialtypharmacy.net supports HTTP/2
     
Verifying HTTP/2.0 Support. Please wait...

Http Header

HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.
x-robots-tag: noindex, nofollow
location: /404.html
cache-control: no-cache, no-store, must-revalidate
pragma: no-cache
expires: 0
content-length: 0
content-type: text/html; charset=UTF-8
date: Wed, 21 Feb 2024 20:39:01 GMT
server: Apache

HTTP/2 200 
x-robots-tag: noindex, nofollow
last-modified: Fri, 19 Jun 2020 04:00:49 GMT
accept-ranges: bytes
vary: Accept-Encoding
content-encoding: gzip
cache-control: no-cache, no-store, must-revalidate
pragma: no-cache
expires: 0
content-length: 462
content-type: text/html
date: Wed, 21 Feb 2024 20:39:01 GMT
server: Apache

DNS Lookup

DNS entries (Domain Name System) are a critical component of the Internet infrastructure. They act as directories that translate human-readable domain names (such as example.com) to machine-readable IP addresses. DNS records are stored on DNS servers and help forward internet traffic efficiently.
Type Ip Target/Txt TTL
A 50.87.144.197 3548
NS ns2091.hostgator.com 172748
NS ns2092.hostgator.com 172748

Whois Lookup

Domain WHOIS is a public database that provides information about domain names, including registered owners, contact information, domain registrars, registration and expiration dates, name servers, and other relevant information. Domain registration for this website began on January 12, 2010 and will expire on January 12, 2025 if not renewed. This website is now assigned through the registrar MarkMonitor Inc.. The WHOIS data for this website's domain was last updated on December 11, 2023.
Domain Created:
2010-01-12
Domain Expires:
2025-01-12
Domain Updated:
2023-12-11
Domain Age:
14 years 6 months 15 days
Domain Registrar:
MarkMonitor Inc.
WhoIs:
 

Domain Name: cvscaremarkspecialtypharmacy.net
Registry Domain ID: 1581642932_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.markmonitor.com
Registrar URL: http://www.markmonitor.com
Updated Date: 2023-12-11T10:32:04+0000
Creation Date: 2010-01-12T21:46:35+0000
Registrar Registration Expiration Date: 2025-01-12T00:00:00+0000
Registrar: MarkMonitor, Inc.
Registrar IANA ID: 292
Registrar Abuse Contact Email: email
Registrar Abuse Contact Phone: +1.2086851750
Domain Status: clientUpdateProhibited (https://www.icann.org/epp#clientUpdateProhibited)
Domain Status: clientTransferProhibited (https://www.icann.org/epp#clientTransferProhibited)
Domain Status: clientDeleteProhibited (https://www.icann.org/epp#clientDeleteProhibited)
Registrant Organization: CVS ***, Inc.
Registrant State/Province: RI
Registrant Country: US
Registrant Email: Select Request Email Form at https://domains.markmonitor.com/whois/cvscaremarkspecialtypharmacy.net
Admin Organization: CVS ***, Inc.
Admin State/Province: RI
Admin Country: US
Admin Email: Select Request Email Form at https://domains.markmonitor.com/whois/cvscaremarkspecialtypharmacy.net
Tech Organization: CVS ***, Inc.
Tech State/Province: RI
Tech Country: US
Tech Email: Select Request Email Form at https://domains.markmonitor.com/whois/cvscaremarkspecialtypharmacy.net
Name Server: ns2092.hostgator.com
Name Server: ns2091.hostgator.com
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2024-02-21T20:39:52+0000