Advancechimneysweepandrepairs.com
Chimney Services Cape Cod, MA | Barnstable, MA
Domain Summary
What is the traffic rank for Advancechimneysweepandrepairs.com?
• Advancechimneysweepandrepairs.com ranks #6,297,717 globally on HypeStat.
What percent of global Internet users visit Advancechimneysweepandrepairs.com?
• 6.0E-7% of global Internet users visit Advancechimneysweepandrepairs.com
How many people visit Advancechimneysweepandrepairs.com each day?
• Advancechimneysweepandrepairs.com receives approximately 29 visitors and 56 page impressions per day.
Which countries does Advancechimneysweepandrepairs.com receive most of its visitors from?
• Advancechimneysweepandrepairs.com is mostly visited by people located in United States,Thailand.
How much Advancechimneysweepandrepairs.com can earn?
• Advancechimneysweepandrepairs.com should earn about $0.20/day from advertising revenue.
What is Advancechimneysweepandrepairs.com estimated value?
• Estimated value of Advancechimneysweepandrepairs.com is $161.33.
What IP addresses does Advancechimneysweepandrepairs.com resolve to?
• Advancechimneysweepandrepairs.com resolves to the IP addresses 199.180.140.11.
Where are Advancechimneysweepandrepairs.com servers located in?
• Advancechimneysweepandrepairs.com has servers located in United States.
advancechimneysweepandrepairs.com Profile

advancechimneysweepandrepairs.com Traffic Analysis
Advancechimneysweepandrepairs.com is ranked #6,297,717 in the world. This website is viewed by an estimated 29 visitors daily, generating a total of 56 pageviews. This equates to about 878.7 monthly visitors.Daily Visitors29
Monthly Visits878.7
Pages per Visit1.92
Visit duration00:17
Bounce Rate42.78%
Is this your site?Verify your site's metrics.
- Daily Unique Visitors:
- 29
- Monthly Visits:
- 879
- Pages per Visit:
- 1.92
- Daily Pageviews:
- 56
- Avg. visit duration:
- 00:17
- Bounce rate:
- 42.78%
- Global Reach:
- 6.0E-7%
- Monthly Visits (SimilarWeb):
- 886
- HypeRank:
- 6,297,717
- SEMrush Rank:
- 5,947,735
- SimilarWeb Rank:
- 13,051,153
Total Visits Last 3 Months
696
JUL
878.7
AUG
878.7
SEP
Visitors by country
- Country
- Users%
- United States 74.47%
- Thailand 25.53%
Backlinks Report ▼
Advancechimneysweepandrepairs.com has a total of 13 backlinks from 13 referring domains and most of them comes from Romania.- Total Backlinks:
- 13
- Follow Links:
- n/a
- Nofollow Links:
- n/a
- Referring Domains:
- 13
- Referring IPs:
- 10
- Authority Domain Score:
- 7
Backlinks by country
- Country
- Domains
- Romania 4
- United States 1
Backlinks by TLDs
- TLD Distribution
- Domains
- .com
- 7
- .eu
- 2
- .dev
- 2
- .edu
- 0
- .gov
- 0
Last update was 352 days ago
This can take up to 60 seconds. Please wait...
This can take up to 60 seconds. Please wait...
*HypeStat.com is not promoting or affiliated with advancechimneysweepandrepairs.com in any way. Only publicly available statistics data are displayed.
Search Engine Indexes ▼
Search engine indexes are huge databases or collections of net pages that search engines like google like google and yahoo use to retrieve applicable facts while customers carry out searches. These indexes are created through search engines like google and yahoo through crawling and indexing net pages from throughout the internet.- Bing Index:
- 17
▼
SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.- Domain:
- advancechimneysweepandrepairs.com
- Rank:
(Rank based on keywords, cost and organic traffic) - 5,947,735
- Organic Keywords:
(Number of keywords in top 20 Google SERP) - 72
- Organic Traffic:
(Number of visitors coming from top 20 search results) - 25
- Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords) - $128.00
Revenue report ▼
Google.com would generate approximately $0.2 per day if the source of income were advertisements, which equates to an estimated monthly revenue of $6 and annual gross revenue of approximately $73. Based on these figures, the site's net worth is estimated at around $161.3.How much would advancechimneysweepandrepairs.com make?
- Daily Revenue:
- $0.20
- Monthly Revenue:
- $6.00
- Yearly Revenue:
- $73.00
Daily earning by country
- CountryPageviewsEarning
- United States 42$0.20
- Thailand 14$0.00
Loss of money due to Adblock?
- Daily Revenue Loss:
- $0.04
- Monthly Revenue Loss:
- $1.09
- Yearly Revenue Loss:
- $13.30
- Daily Pageviews Blocked:
- 8
- Monthly Pageviews Blocked:
- 251
- Yearly Pageviews Blocked:
- 3,053
Daily revenue loss by country
- CountryBlockedLost Money
- United States 8$0.04
- Thailand 1$0.00
How much is advancechimneysweepandrepairs.com worth?
- Website Value:
- $161.3
Ad Experience Report ▼
Summary of the ad experience rating of a website for a specific platform.Mobile summary
- Root domain:
- advancechimneysweepandrepairs.com
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Desktop summary
- Root domain:
- advancechimneysweepandrepairs.com
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Abusive Experience Report ▼
Summary of the abusive experience rating of a website.- Root domain:
- advancechimneysweepandrepairs.com
- Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.) - Off
- Status:
(The status of the site reviewed for the abusive experiences.) - Not reviewed
Where is advancechimneysweepandrepairs.com hosted? ▼
Advancechimneysweepandrepairs.com may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.- Server IP:
- 199.180.140.11
- ASN:
- AS14618
- ISP:
- Amazon.com, Inc.
- Server Location:
United States, US
Other sites hosted on 199.180.140.11
How fast does advancechimneysweepandrepairs.com load? ▼
The average loading time of advancechimneysweepandrepairs.com is 286 ms.- Average Load Time:
- 286 ms
Does advancechimneysweepandrepairs.com use compression? ▼
Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on advancechimneysweepandrepairs.com are reduced by 75%.
advancechimneysweepandrepairs.com use gzip compression.
Original size: 283.17 KB
Compressed size: 70.78 KB
File reduced by: 212.4 KB (75%)
Compressed size: 70.78 KB
File reduced by: 212.4 KB (75%)
Google Safe Browsing ▼
Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.SSL Checker - SSL Certificate Verify ▼
An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. advancechimneysweepandrepairs.com supports HTTPS. advancechimneysweepandrepairs.com supports HTTPS
Verifying SSL Support. Please wait...
Common Name: www.advancechimneysweepandrepairs.com
Organization:
Location:
Issuer: R10
Valid from: Sep 26 12:34:17 2024 GMT
Valid until: Dec 25 12:34:16 2024 GMT
Authority: CA:FALSE
Keysize: 4096 Bits
Organization:
Location:
Issuer: R10
Valid from: Sep 26 12:34:17 2024 GMT
Valid until: Dec 25 12:34:16 2024 GMT
Authority: CA:FALSE
Keysize: 4096 Bits
Common Name: R10
Organization: Let's Encrypt
Location: US
Issuer: ISRG Root X1
Valid from: Mar 13 00:00:00 2024 GMT
Valid until: Mar 12 23:59:59 2027 GMT
Authority: CA:TRUE
Keysize: 2048 Bits
Organization: Let's Encrypt
Location: US
Issuer: ISRG Root X1
Valid from: Mar 13 00:00:00 2024 GMT
Valid until: Mar 12 23:59:59 2027 GMT
Authority: CA:TRUE
Keysize: 2048 Bits
Verify HTTP/2 Support ▼
HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency. advancechimneysweepandrepairs.com does not support HTTP/2
Verifying HTTP/2.0 Support. Please wait...
Http Header ▼
HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.server: nginx
date: Thu, 24 Oct 2024 12:26:02 GMT
content-type: text/html
content-length: 162
d-cache: from-cache
cache-control: no-cache, no-store, must-revalidate
expires: Thu, 01 Jan 1970 00:00:00 GMT
x-content-type-options: nosniff
strict-transport-security: max-age=31536000; preload
x-frame-options: SAMEORIGIN
content-security-policy: frame-ancestors 'self'
speculation-rules: "https://static-res-cdn.websites.hibu.com/speculations/rules/prerender-1.0.3.json"
location: https://www.advancechimneysweepandrepairs.com/
d-geo: US
HTTP/1.1 200 OK
Content-Type: text/html;charset=utf-8
Transfer-Encoding: chunked
Connection: keep-alive
X-Frame-Options: SAMEORIGIN
Content-Security-Policy: frame-ancestors 'self'
Expires: Thu, 01 Jan 1970 00:00:00 GMT
X-Content-Type-Options: nosniff
Cache-Control: no-store
Cache-Control: no-cache, no-store, must-revalidate
Cache-Control: max-age=0
Vary: user-agent,accept-encoding
Speculation-Rules: "https://static-res-cdn.websites.hibu.com/speculations/rules/prerender-1.0.3.json"
X-Zen-Fury: c5525a912a0262a228c751827b735a4e2e002d46
Strict-Transport-Security: max-age=31536000; preload
D-Geo: US
Date: Thu, 24 Oct 2024 12:26:02 GMT
Server: ZENEDGE
X-Cache-Status: MISS
d-cache: from-cache
Link: <https://le-cdn.hibuwebsites.com/d78de9e1c6dc4ed1927d7d573c9ccf28/dms3rep/multi/opt/advance-chimney-hero-home-1920w.png>; rel=preload; as=image; fetchpriority=high
X-Cdn: Served-By-Zenedge
Content-Encoding: gzip
DNS Lookup ▼
DNS entries (Domain Name System) are a critical component of the Internet infrastructure. They act as directories that translate human-readable domain names (such as example.com) to machine-readable IP addresses. DNS records are stored on DNS servers and help forward internet traffic efficiently.Type | Ip | Target/Txt | TTL |
SOA | 300 | ||
Mname | ns1.systemdns.com | ||
Rname | hostmaster.systemdns.com | ||
Serial Number | 1711115489 | ||
Refresh | 10800 | ||
Retry | 3600 | ||
Expire | 1209600 | ||
Minimum TTL | 60 | ||
TXT | 300 | ||
MX | 300 | ||
A | 199.180.140.11 | 243 | |
NS | 300 | ||
NS | 300 | ||
NS | 300 |
Whois Lookup ▼
Domain WHOIS is a public database that provides information about domain names, including registered owners, contact information, domain registrars, registration and expiration dates, name servers, and other relevant information. Domain registration for this website began on April 5, 2023 and will expire on April 5, 2025 if not renewed. This website is now assigned through the registrar Tucows Domains Inc.. The WHOIS data for this website's domain was last updated on March 7, 2024.- Domain Created:
- 2023-04-05
- Domain Expires:
- 2025-04-05
- Domain Updated:
- 2024-03-07
- Domain Age:
- 2 years 6 months 7 days
- Domain Registrar:
- Tucows Domains Inc.
- WhoIs:
Domain Name: ADVANCECHIMNEYSWEEPANDREPAIRS.COM Registry Domain ID: 2770792034_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.tucows.com Registrar URL: http://www.tucows.com Updated Date: 2024-03-07T06:03:13Z Creation Date: 2023-04-05T21:04:20Z Registry Expiry Date: 2025-04-05T21:04:20Z Registrar: Tucows Domains Inc. Registrar IANA ID: 69 Registrar Abuse Contact Email:Registrar Abuse Contact Phone: +1.4165350123 Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited Name Server: NS1.SYSTEMDNS.COM Name Server: NS2.SYSTEMDNS.COM Name Server: NS3.SYSTEMDNS.COM DNSSEC: unsigned URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of whois database: 2024-10-24T12:26:49Z