Wallstreetenglish.ma
Pour ceux qui veulent aller plus loin
Domain Summary
What is the traffic rank for Wallstreetenglish.ma?
• Wallstreetenglish.ma ranks #5,392,936 globally on HypeStat.
What percent of global Internet users visit Wallstreetenglish.ma?
• 2.5E-6% of global Internet users visit Wallstreetenglish.ma
How many people visit Wallstreetenglish.ma each day?
• Wallstreetenglish.ma receives approximately 122 visitors and 154 page impressions per day.
Which countries does Wallstreetenglish.ma receive most of its visitors from?
• Wallstreetenglish.ma is mostly visited by people located in Morocco.
How much Wallstreetenglish.ma can earn?
• Wallstreetenglish.ma should earn about $0.09/day from advertising revenue.
What is Wallstreetenglish.ma estimated value?
• Estimated value of Wallstreetenglish.ma is $71.44.
What IP addresses does Wallstreetenglish.ma resolve to?
• Wallstreetenglish.ma resolves to the IP addresses 52.48.15.204.
Where are Wallstreetenglish.ma servers located in?
• Wallstreetenglish.ma has servers located in Dublin, Leinster, D02, Ireland.
wallstreetenglish.ma Profile

Title:Pour ceux qui veulent aller plus loin
Description:Nous permettons aux apprenants d'aller plus loin dans leur apprentissage de l'anglais. Rejoignez nous maintenant!
Category:Science and Education / Education
What technologies does wallstreetenglish.ma use?
These are the technologies used at wallstreetenglish.ma. wallstreetenglish.ma has a total of 2 technologies installed in 3 different categories.wallstreetenglish.ma Traffic Analysis
Wallstreetenglish.ma is ranked #5,392,936 in the world. This website is viewed by an estimated 122 visitors daily, generating a total of 154 pageviews. This equates to about 3.7K monthly visitors. Wallstreetenglish.ma traffic has decreased by 86.67% compared to last month.Daily Visitors122
86.63%
Monthly Visits3.7K
86.67%
Pages per Visit1.26
3.17%
Visit duration00:33
89.81%
Bounce Rate76.86%
22.3%
Is this your site?Verify your site's metrics.
- Daily Unique Visitors:
- 122
- Monthly Visits:
- 3,697
- Pages per Visit:
- 1.26
- Daily Pageviews:
- 154
- Avg. visit duration:
- 00:33
- Bounce rate:
- 76.86%
- Global Reach:
- 2.5E-6%
- Monthly Visits (SEMrush):
- 425
- Monthly Unique Visitors (SEMrush):
- 361
- Monthly Visits (SimilarWeb):
- 3,631
- HypeRank:
- 5,392,936
- SEMrush Rank:
- 8,515,991
- SimilarWeb Rank:
- 5,392,936
Traffic sources
- Direct:
- 0%
- Referral:
- 15.29%
- Search:
- 50.82%
- Social:
- 16.94%
- Paid:
- 16.94%
Desktop vs Mobile
- Desktop:
- 100.00%
- Mobile:
- 0%
Total Visits Last 3 Months
842
NOV
27.7K
DEC
3.7K
JAN
Visitors by country
- Country
- Users%
- Morocco 100.00%
Backlinks Report ▼
Wallstreetenglish.ma has a total of 63 backlinks from 51 referring domains and most of them comes from United States.- Total Backlinks:
- 63
- Follow Links:
- n/a
- Nofollow Links:
- n/a
- Referring Domains:
- 51
- Referring IPs:
- 47
- Authority Domain Score:
- 18
Backlinks by country
- Country
- Domains
- United States 11
- Romania 3
- France 2
- Singapore 1
Backlinks by TLDs
- TLD Distribution
- Domains
- .com
- 39
- .dev
- 4
- .online
- 2
- .edu
- 0
- .gov
- 0
Which sites are competitors to wallstreetenglish.ma?
Websites similar to wallstreetenglish.ma are sites similar on user interests and browsing behavior. Users can discover new websites that are similar to the ones they already enjoy or find useful.- Domain
- CompareDaily Visitors
- cursussup.gov.ma
- Compare >90.4K
- kezakoo.com
- Compare >11.4K
- uit.ac.ma
- Compare >7.7K
- misaha.com
- Compare >6.4K
- francais4arabe.com
- Compare >4.4K
- inscription.ma
- Compare >2.5K
- speakenglishwithtiffaniacademy.com
- Compare >1.6K
- langues24.com
- Compare >1.1K
- capmission.ma
- Compare >1.1K
- osd.ma
- Compare >829
- honoris.net
- Compare >793
- eigsica.ma
- Compare >750
- taalime24.com
- Compare >513
- 9rytna.info
- Compare >363
- jereussirai.com
- Compare >110
- arabe-francais.com
- Compare >92
- formation-continue.ma
- Compare >64
- calliope.ma
- Compare >8
- yassinderraz.com
- Compare >7
- capres.ca
- Compare >5
Last update was 33 days ago
This can take up to 60 seconds. Please wait...
This can take up to 60 seconds. Please wait...
*HypeStat.com is not promoting or affiliated with wallstreetenglish.ma in any way. Only publicly available statistics data are displayed.
Search Engine Indexes ▼
Search engine indexes are huge databases or collections of net pages that search engines like google like google and yahoo use to retrieve applicable facts while customers carry out searches. These indexes are created through search engines like google and yahoo through crawling and indexing net pages from throughout the internet.- Google Index:
- 87
▼
SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.- Domain:
- wallstreetenglish.ma
- Rank:
(Rank based on keywords, cost and organic traffic) - 8,515,991
- Organic Keywords:
(Number of keywords in top 20 Google SERP) - 2
- Organic Traffic:
(Number of visitors coming from top 20 search results) - 7
- Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords) - $0.00
Revenue report ▼
Google.com would generate approximately $0.1 per day if the source of income were advertisements, which equates to an estimated monthly revenue of $2.7 and annual gross revenue of approximately $32.9. Based on these figures, the site's net worth is estimated at around $71.4.How much would wallstreetenglish.ma make?
- Daily Revenue:
- $0.09
- Monthly Revenue:
- $2.70
- Yearly Revenue:
- $32.85
Daily earning by country
- CountryPageviewsEarning
- Morocco 154$0.09
Daily revenue loss by country
- CountryBlockedLost Money
- Morocco 3$0.00
How much is wallstreetenglish.ma worth?
- Website Value:
- $71.4
Ad Experience Report ▼
Summary of the ad experience rating of a website for a specific platform.Mobile summary
- Root domain:
- wallstreetenglish.ma
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Desktop summary
- Root domain:
- wallstreetenglish.ma
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Abusive Experience Report ▼
Summary of the abusive experience rating of a website.- Root domain:
- wallstreetenglish.ma
- Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.) - Off
- Status:
(The status of the site reviewed for the abusive experiences.) - Not reviewed
Where is wallstreetenglish.ma hosted? ▼
Wallstreetenglish.ma may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.- Server IP:
- 52.48.15.204
- ASN:
- AS16509
- ISP:
- Amazon.com, Inc.
- Server Location:
- Dublin
Leinster, L
D02
Ireland, IE
Other sites hosted on 52.48.15.204
How fast does wallstreetenglish.ma load? ▼
The average loading time of wallstreetenglish.ma is 1449 ms.- Average Load Time:
- 1449 ms
Does wallstreetenglish.ma use compression? ▼
Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on wallstreetenglish.ma are reduced by 74%.
wallstreetenglish.ma use gzip compression.
Original size: 507.39 KB
Compressed size: 130.26 KB
File reduced by: 377.14 KB (74%)
Compressed size: 130.26 KB
File reduced by: 377.14 KB (74%)
Google Safe Browsing ▼
Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.SSL Checker - SSL Certificate Verify ▼
An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. wallstreetenglish.ma supports HTTPS. wallstreetenglish.ma supports HTTPS
Verifying SSL Support. Please wait...
Common Name: *.wallstreetenglish.dz
Organization:
Location:
Issuer: R11
Valid from: Jan 16 17:42:14 2025 GMT
Valid until: Apr 16 17:42:13 2025 GMT
Authority: CA:FALSE
Keysize: 2048 Bits
Organization:
Location:
Issuer: R11
Valid from: Jan 16 17:42:14 2025 GMT
Valid until: Apr 16 17:42:13 2025 GMT
Authority: CA:FALSE
Keysize: 2048 Bits
Common Name: *.wallstreetenglish.dz
Organization:
Location:
Issuer: R11
Valid from: Jan 16 17:42:14 2025 GMT
Valid until: Apr 16 17:42:13 2025 GMT
Authority: CA:FALSE
Keysize: 2048 Bits
Organization:
Location:
Issuer: R11
Valid from: Jan 16 17:42:14 2025 GMT
Valid until: Apr 16 17:42:13 2025 GMT
Authority: CA:FALSE
Keysize: 2048 Bits
Common Name: R11
Organization: Let's Encrypt
Location: US
Issuer: ISRG Root X1
Valid from: Mar 13 00:00:00 2024 GMT
Valid until: Mar 12 23:59:59 2027 GMT
Authority: CA:TRUE
Keysize: 2048 Bits
Organization: Let's Encrypt
Location: US
Issuer: ISRG Root X1
Valid from: Mar 13 00:00:00 2024 GMT
Valid until: Mar 12 23:59:59 2027 GMT
Authority: CA:TRUE
Keysize: 2048 Bits
Verify HTTP/2 Support ▼
HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency. wallstreetenglish.ma supports HTTP/2
Verifying HTTP/2.0 Support. Please wait...
Http Header ▼
HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.Server: nginx/1.18.0 (Ubuntu)
Date: Sat, 15 Feb 2025 13:12:02 GMT
Content-Type: text/html
Content-Length: 178
Connection: keep-alive
Location: https://www.wallstreetenglish.dz/
HTTP/2 200
content-type: text/html
date: Sat, 15 Feb 2025 13:12:04 GMT
last-modified: Fri, 14 Feb 2025 12:30:45 GMT
etag: W/"9d5e5f0c3381373e587fab55c7c7c7cc"
x-amz-server-side-encryption: AES256
server: AmazonS3
content-encoding: gzip
vary: Accept-Encoding
x-cache: Miss from cloudfront
via: 1.1 11ba7cf61f8ee8331f744925c9c4cf68.cloudfront.net (CloudFront)
x-amz-cf-pop: ORD56-P12
x-amz-cf-id: zMKrwc2tsVcEgdKLS7StoilwFRO0iqSrnNmwXzoB1UsQeoq8QXCZ9w==
cache-control: public, max-age=31536000, immutable
DNS Lookup ▼
DNS entries (Domain Name System) are a critical component of the Internet infrastructure. They act as directories that translate human-readable domain names (such as example.com) to machine-readable IP addresses. DNS records are stored on DNS servers and help forward internet traffic efficiently.Type | Ip | Target/Txt | TTL |
A | 52.48.15.204 | 3538 | |
NS | 107938 | ||
NS | 107938 | ||
NS | 107938 | ||
NS | 107938 | ||
HINFO | 300 |
Whois Lookup ▼
Domain WHOIS is a public database that provides information about domain names, including registered owners, contact information, domain registrars, registration and expiration dates, name servers, and other relevant information. Domain registration for this website began on November 1, 2023 and will expire on November 1, 2025 if not renewed. This website is now assigned through the registrar ARCANES TECHNOLOGIES. The WHOIS data for this website's domain was last updated on October 28, 2024.- Domain Created:
- 2023-11-01
- Domain Expires:
- 2025-11-01
- Domain Updated:
- 2024-10-28
- Domain Age:
- 1 years 4 months 19 days
- Domain Registrar:
- ARCANES TECHNOLOGIES
- Domain Owner:
- REDACTED FOR PRIVACY
- WhoIs:
Domain Name: wallstreetenglish.ma Updated Date: 2024-10-28T15:50:01Z Creation Date: 2023-11-01T08:32:44Z Registry Expiry Date: 2025-11-01T08:32:44Z Registrar Registration Expiration Date: 2025-11-01T08:32:44Z Registrar: ARCANES TECHNOLOGIES Registrar Street Address: Technopark, Rte Nouaceur, angle RS114 et CT1029, RDC - Bureau 143bis Casablanca 20153 Registrar Email:Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Registry Registrant ID: 6254979- Registrant Name: ECOLE MAROCAINE DES SCIENCES DE L'INGENIEUR Registrant Organization: REDACTED FOR PRIVACY Registrant Street: REDACTED FOR PRIVACY Registrant City: REDACTED FOR PRIVACY Registrant State/Province: REDACTED FOR PRIVACY Registrant Postal Code: REDACTED FOR PRIVACY Registrant Country: Registrant Phone: REDACTED FOR PRIVACY Registrant Email: REDACTED FOR PRIVACY Registry Admin ID: 6272819- Admin Name: Ridouane OUMOUMEN Admin Organization: REDACTED FOR PRIVACY Admin Street: REDACTED FOR PRIVACY Admin City: REDACTED FOR PRIVACY Admin State/Province: REDACTED FOR PRIVACY Admin Postal Code: REDACTED FOR PRIVACY Admin Country: MA Admin Phone: +212.661967750 Admin Email:
Registry Tech ID: 6272820- Tech Name: Ridouane OUMOUMEN Tech Organization: REDACTED FOR PRIVACY Tech Street: REDACTED FOR PRIVACY Tech City: REDACTED FOR PRIVACY Tech State/Province: REDACTED FOR PRIVACY Tech Postal Code: REDACTED FOR PRIVACY Tech Country: Tech Phone: +212.661967750 Tech Email:
Name Server: ns4.bdm.microsoftonline.com Name Server: ns2.bdm.microsoftonline.com Name Server: ns3.bdm.microsoftonline.com Name Server: ns1.bdm.microsoftonline.com DNSSEC: unsigned URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2025-02-15T13:13:08.640Z