Langbird.com
Error | Langbird
Domain Summary
What is the traffic rank for Langbird.com?
• Langbird.com ranks #7,608,899 globally on HypeStat.
What percent of global Internet users visit Langbird.com?
• 1.3E-6% of global Internet users visit Langbird.com
How many people visit Langbird.com each day?
• Langbird.com receives approximately 62 visitors and 104 page impressions per day.
Which countries does Langbird.com receive most of its visitors from?
• Langbird.com is mostly visited by people located in Sweden.
How much Langbird.com can earn?
• Langbird.com should earn about $0.14/day from advertising revenue.
What is Langbird.com estimated value?
• Estimated value of Langbird.com is $143.96.
What IP addresses does Langbird.com resolve to?
• Langbird.com resolves to the IP addresses 13.74.158.5.
Where are Langbird.com servers located in?
• Langbird.com has servers located in Dublin, Leinster, D02, Ireland.
langbird.com Profile
Title:Error | Langbird
Description:learn englishlearn frenchlearn spanishlearn italianlearn germanvocabulary trainerenglishfrenchspanishitaliangermanenglish vocabulary trainerfrench vocabulary trainerspanish vocabulary traineritalian vocabulary trainergerman vocabulary trainerfrench conjugationsitalian conjugationsspanish conjugationsgerman conjugationsfrench grammar traineritalian grammar trainerspanish grammar trainergerman grammar trainerlanguage learning softwarelanguage learning appslanguage learning applär dig engelskalär dig franskalär dig spanskalär dig italienskalär dig tyskaordförrådglosövningengelskafranskaspanskaitalienskatyskaengelska glosövningarfranska glosövningarspanska glosövningartyska glosövningaritalienska glosövningarfranska konjugationeritalienska konjugationerspanska konjugationertyska konjugationerfranska grammatikövningaritalienska grammatikövningarspanska grammatikövningartyska grammatikövningarengelska grammatikövningarspråkprogramspråkinlärningspråk-appspråk appar
langbird.com Traffic Analysis
Langbird.com is ranked #7,608,899 in the world. This website is viewed by an estimated 62 visitors daily, generating a total of 104 pageviews. This equates to about 1.9K monthly visitors. Langbird.com traffic has increased by 558.01% compared to last month.Daily Visitors62
113.85%
Monthly Visits1.9K
558.01%
Pages per Visit1.68
559%
Visit duration00:38
Bounce Rate36.50%
73.88%
Is this your site?Verify your site's metrics.
- Daily Unique Visitors:
- 62
- Monthly Visits:
- 1,879
- Pages per Visit:
- 1.68
- Daily Pageviews:
- 104
- Avg. visit duration:
- 00:38
- Bounce rate:
- 36.50%
- Global Reach:
- 1.3E-6%
- Monthly Visits (SEMrush):
- 1,520
- Monthly Unique Visitors (SEMrush):
- 494
- Monthly Visits (SimilarWeb):
- 1,818
- HypeRank:
- 7,608,899
- SEMrush Rank:
- 16,338,047
- SimilarWeb Rank:
- 7,608,899
Traffic sources
- Direct:
- 70.03%
- Referral:
- 0%
- Search:
- 6.62%
- Social:
- 0%
- Paid:
- 23.34%
Desktop vs Mobile
- Desktop:
- 100.00%
- Mobile:
- 0%
Total Visits Last 3 Months
3.3K
JAN
285.5
FEB
1.9K
MAR
Visitors by country
- Country
- Users%
- Sweden 100.00%
Backlinks Report ▼
Langbird.com has a total of 292 backlinks from 66 referring domains and most of them comes from United States.- Total Backlinks:
- 292
- Follow Links:
- n/a
- Nofollow Links:
- n/a
- Referring Domains:
- 66
- Referring IPs:
- 68
- Authority Domain Score:
- 16
Backlinks by country
- Country
- Domains
- United States 7
- Netherlands 3
- Sweden 2
- France 1
- Singapore 1
Backlinks by TLDs
- TLD Distribution
- Domains
- .com
- 18
- .info
- 8
- .se
- 4
- .edu
- 0
- .gov
- 0
Last update was 197 days ago
This can take up to 60 seconds. Please wait...
This can take up to 60 seconds. Please wait...
*HypeStat.com is not promoting or affiliated with langbird.com in any way. Only publicly available statistics data are displayed.
Search Engine Indexes ▼
Search engine indexes are huge databases or collections of net pages that search engines like google like google and yahoo use to retrieve applicable facts while customers carry out searches. These indexes are created through search engines like google and yahoo through crawling and indexing net pages from throughout the internet.- Google Index:
- 102
▼
SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.- Domain:
- langbird.com
- Rank:
(Rank based on keywords, cost and organic traffic) - 16,338,047
- Organic Keywords:
(Number of keywords in top 20 Google SERP) - 9
- Organic Traffic:
(Number of visitors coming from top 20 search results) - 0
- Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords) - $0.00
Revenue report ▼
Google.com would generate approximately $0.1 per day if the source of income were advertisements, which equates to an estimated monthly revenue of $4.2 and annual gross revenue of approximately $51.1. Based on these figures, the site's net worth is estimated at around $144.How much would langbird.com make?
- Daily Revenue:
- $0.14
- Monthly Revenue:
- $4.20
- Yearly Revenue:
- $51.10
Daily earning by country
- CountryPageviewsEarning
- Sweden 104$0.14
Loss of money due to Adblock?
- Daily Revenue Loss:
- $0.04
- Monthly Revenue Loss:
- $1.18
- Yearly Revenue Loss:
- $14.35
- Daily Pageviews Blocked:
- 29
- Monthly Pageviews Blocked:
- 874
- Yearly Pageviews Blocked:
- 10,629
Daily revenue loss by country
- CountryBlockedLost Money
- Sweden 29$0.04
How much is langbird.com worth?
- Website Value:
- $144
Ad Experience Report ▼
Summary of the ad experience rating of a website for a specific platform.Mobile summary
- Root domain:
- langbird.com
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Desktop summary
- Root domain:
- langbird.com
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Abusive Experience Report ▼
Summary of the abusive experience rating of a website.- Root domain:
- langbird.com
- Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.) - Off
- Status:
(The status of the site reviewed for the abusive experiences.) - Not reviewed
Where is langbird.com hosted? ▼
Langbird.com may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.- Server IP:
- 13.74.158.5
- ASN:
- AS8075
- ISP:
- Microsoft Corporation
- Server Location:
- Dublin
Leinster, L
D02
Ireland, IE
Other sites hosted on 13.74.158.5
How fast does langbird.com load? ▼
The average loading time of langbird.com is 683 ms. The Desktop speed index is 96 and mobile speed index is 87.- Average Load Time:
- 683 ms
Page Speed (Google PageSpeed Insights) - Desktop
Field Data
Over the last 30 days, the field data shows that this page has a AVERAGE speed compared to other pages in the Chrome User Experience Report.We are showing the 90th percentile of FCP and the 95th percentile of FID.
Cumulative Layout Shift (CLS)12ms
Time To First Byte (TTFB)478ms
First Contentful Paint (FCP)923ms
First Input Delay (FID)0
Interaction To Next Paint (INP)57ms
Largest Contentful Paint (LCP)1.4s
Origin Data
All pages served from this origin have an AVERAGE speed compared to other pages in the Chrome User Experience Report. over the last 30 days.To view suggestions tailored to each page, analyze individual page URLs.
Cumulative Layout Shift (CLS)12ms
Time To First Byte (TTFB)478ms
First Contentful Paint (FCP)923ms
First Input Delay (FID)0
Interaction To Next Paint (INP)57ms
Largest Contentful Paint (LCP)1.4s
Lab Data
Largest Contentful Paint image was not lazily loaded
Above-the-fold images that are lazily loaded render later in the page lifecycle, which can delay the largest contentful paint. Learn more about optimal lazy loading
Above-the-fold images that are lazily loaded render later in the page lifecycle, which can delay the largest contentful paint. Learn more about optimal lazy loading
Duplicated JavaScript
Remove large, duplicate JavaScript modules from bundles to reduce unnecessary bytes consumed by network activity.
Remove large, duplicate JavaScript modules from bundles to reduce unnecessary bytes consumed by network activity.
Largest Contentful Paint 1.1 s
Largest Contentful Paint marks the time at which the largest text or image is painted. Learn more about the Largest Contentful Paint metric
Largest Contentful Paint marks the time at which the largest text or image is painted. Learn more about the Largest Contentful Paint metric
Preload Largest Contentful Paint image
If the LCP element is dynamically added to the page, you should preload the image in order to improve LCP. Learn more about preloading LCP elements
If the LCP element is dynamically added to the page, you should preload the image in order to improve LCP. Learn more about preloading LCP elements
Time to Interactive 1.4 s
Time to Interactive is the amount of time it takes for the page to become fully interactive. Learn more about the Time to Interactive metric
Time to Interactive is the amount of time it takes for the page to become fully interactive. Learn more about the Time to Interactive metric
Speed Index 1.4 s
Speed Index shows how quickly the contents of a page are visibly populated. Learn more about the Speed Index metric
Speed Index shows how quickly the contents of a page are visibly populated. Learn more about the Speed Index metric
First Contentful Paint 0.7 s
First Contentful Paint marks the time at which the first text or image is painted. Learn more about the First Contentful Paint metric
First Contentful Paint marks the time at which the first text or image is painted. Learn more about the First Contentful Paint metric
Legacy JavaScript
Polyfills and transforms enable legacy browsers to use new JavaScript features. However, many aren't necessary for modern browsers. Consider modifying your JavaScript build process to not transpile features, unless you know you must support legacy browsers. Baseline Learn why most sites can deploy ES6+ code without transpiling
Polyfills and transforms enable legacy browsers to use new JavaScript features. However, many aren't necessary for modern browsers. Consider modifying your JavaScript build process to not transpile features, unless you know you must support legacy browsers. Baseline Learn why most sites can deploy ES6+ code without transpiling
First Meaningful Paint
First Meaningful Paint measures when the primary content of a page is visible. Learn more about the First Meaningful Paint metric
First Meaningful Paint measures when the primary content of a page is visible. Learn more about the First Meaningful Paint metric
Lazy load third-party resources with facades
Some third-party embeds can be lazy loaded. Consider replacing them with a facade until they are required. Learn how to defer third-parties with a facade
Some third-party embeds can be lazy loaded. Consider replacing them with a facade until they are required. Learn how to defer third-parties with a facade
INP by phase
Start investigating with the longest phase. To reduce processing duration, , often JS. Delays can be minimized optimize the main-thread costs
Start investigating with the longest phase. To reduce processing duration, , often JS. Delays can be minimized optimize the main-thread costs
Font display
Consider setting to swap or optional to ensure text is consistently visible. swap can be further optimized to mitigate layout shifts with . font-display font metric overrides
Consider setting to swap or optional to ensure text is consistently visible. swap can be further optimized to mitigate layout shifts with . font-display font metric overrides
LCP request discovery
Optimize LCP by making the LCP image from the HTML immediately, and discoverable avoiding lazy-loading
Optimize LCP by making the LCP image from the HTML immediately, and discoverable avoiding lazy-loading
Max Potential First Input Delay 120 ms
The maximum potential First Input Delay that your users could experience is the duration of the longest task. Learn more about the Maximum Potential First Input Delay metric
The maximum potential First Input Delay that your users could experience is the duration of the longest task. Learn more about the Maximum Potential First Input Delay metric
Total Blocking Time 80 ms
Sum of all time periods between FCP and Time to Interactive, when task length exceeded 50ms, expressed in milliseconds. Learn more about the Total Blocking Time metric
Sum of all time periods between FCP and Time to Interactive, when task length exceeded 50ms, expressed in milliseconds. Learn more about the Total Blocking Time metric
Page Speed (Google PageSpeed Insights) - Mobile
Field Data
Over the last 30 days, the field data shows that this page has a FAST speed compared to other pages in the Chrome User Experience Report.We are showing the 90th percentile of FCP and the 95th percentile of FID.
Cumulative Layout Shift (CLS)0ms
Time To First Byte (TTFB)506ms
First Contentful Paint (FCP)835ms
First Input Delay (FID)0
Interactive To Next Paint (INP)102ms
Largest Contentful Paint (LCP)1.2s
Origin Data
All pages served from this origin have an FAST speed compared to other pages in the Chrome User Experience Report. over the last 30 days.To view suggestions tailored to each page, analyze individual page URLs.
Cumulative Layout Shift (CLS)0ms
Time To First Byte (TTFB)506ms
First Contentful Paint (FCP)835ms
First Input Delay (FID)0
Interactive To Next Paint (INP)102ms
Largest Contentful Paint (LCP)1.2s
Lab Data
Time to Interactive 5.2 s
Time to Interactive is the amount of time it takes for the page to become fully interactive. Learn more about the Time to Interactive metric
Time to Interactive is the amount of time it takes for the page to become fully interactive. Learn more about the Time to Interactive metric
Largest Contentful Paint image was not lazily loaded
Above-the-fold images that are lazily loaded render later in the page lifecycle, which can delay the largest contentful paint. Learn more about optimal lazy loading
Above-the-fold images that are lazily loaded render later in the page lifecycle, which can delay the largest contentful paint. Learn more about optimal lazy loading
LCP request discovery
Optimize LCP by making the LCP image from the HTML immediately, and discoverable avoiding lazy-loading
Optimize LCP by making the LCP image from the HTML immediately, and discoverable avoiding lazy-loading
Preload Largest Contentful Paint image
If the LCP element is dynamically added to the page, you should preload the image in order to improve LCP. Learn more about preloading LCP elements
If the LCP element is dynamically added to the page, you should preload the image in order to improve LCP. Learn more about preloading LCP elements
Duplicated JavaScript
Remove large, duplicate JavaScript modules from bundles to reduce unnecessary bytes consumed by network activity.
Remove large, duplicate JavaScript modules from bundles to reduce unnecessary bytes consumed by network activity.
First Meaningful Paint
First Meaningful Paint measures when the primary content of a page is visible. Learn more about the First Meaningful Paint metric
First Meaningful Paint measures when the primary content of a page is visible. Learn more about the First Meaningful Paint metric
Lazy load third-party resources with facades
Some third-party embeds can be lazy loaded. Consider replacing them with a facade until they are required. Learn how to defer third-parties with a facade
Some third-party embeds can be lazy loaded. Consider replacing them with a facade until they are required. Learn how to defer third-parties with a facade
Max Potential First Input Delay 120 ms
The maximum potential First Input Delay that your users could experience is the duration of the longest task. Learn more about the Maximum Potential First Input Delay metric
The maximum potential First Input Delay that your users could experience is the duration of the longest task. Learn more about the Maximum Potential First Input Delay metric
First Contentful Paint 2.6 s
First Contentful Paint marks the time at which the first text or image is painted. Learn more about the First Contentful Paint metric
First Contentful Paint marks the time at which the first text or image is painted. Learn more about the First Contentful Paint metric
Largest Contentful Paint 3.2 s
Largest Contentful Paint marks the time at which the largest text or image is painted. Learn more about the Largest Contentful Paint metric
Largest Contentful Paint marks the time at which the largest text or image is painted. Learn more about the Largest Contentful Paint metric
Legacy JavaScript
Polyfills and transforms enable legacy browsers to use new JavaScript features. However, many aren't necessary for modern browsers. Consider modifying your JavaScript build process to not transpile features, unless you know you must support legacy browsers. Baseline Learn why most sites can deploy ES6+ code without transpiling
Polyfills and transforms enable legacy browsers to use new JavaScript features. However, many aren't necessary for modern browsers. Consider modifying your JavaScript build process to not transpile features, unless you know you must support legacy browsers. Baseline Learn why most sites can deploy ES6+ code without transpiling
INP by phase
Start investigating with the longest phase. To reduce processing duration, , often JS. Delays can be minimized optimize the main-thread costs
Start investigating with the longest phase. To reduce processing duration, , often JS. Delays can be minimized optimize the main-thread costs
Speed Index 4.1 s
Speed Index shows how quickly the contents of a page are visibly populated. Learn more about the Speed Index metric
Speed Index shows how quickly the contents of a page are visibly populated. Learn more about the Speed Index metric
Total Blocking Time 110 ms
Sum of all time periods between FCP and Time to Interactive, when task length exceeded 50ms, expressed in milliseconds. Learn more about the Total Blocking Time metric
Sum of all time periods between FCP and Time to Interactive, when task length exceeded 50ms, expressed in milliseconds. Learn more about the Total Blocking Time metric
Font display
Consider setting to swap or optional to ensure text is consistently visible. swap can be further optimized to mitigate layout shifts with . font-display font metric overrides
Consider setting to swap or optional to ensure text is consistently visible. swap can be further optimized to mitigate layout shifts with . font-display font metric overrides
Does langbird.com use compression? ▼
Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on langbird.com are reduced by %.
langbird.com does not use compression.
Original size: 14.28 KB
Compressed size: n/a
File reduced by: (%)
Compressed size: n/a
File reduced by: (%)
Google Safe Browsing ▼
Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.SSL Checker - SSL Certificate Verify ▼
An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. langbird.com supports HTTPS. langbird.com supports HTTPS
Verifying SSL Support. Please wait...
Common Name: langbird.com
Organization:
Location:
Issuer: GeoTrust Global TLS RSA4096 SHA256 2022 CA1
Valid from: Feb 19 00:00:00 2025 GMT
Valid until: Aug 19 23:59:59 2025 GMT
Authority: CA:FALSE
Keysize: 2048 Bits
Organization:
Location:
Issuer: GeoTrust Global TLS RSA4096 SHA256 2022 CA1
Valid from: Feb 19 00:00:00 2025 GMT
Valid until: Aug 19 23:59:59 2025 GMT
Authority: CA:FALSE
Keysize: 2048 Bits
Common Name: GeoTrust Global TLS RSA4096 SHA256 2022 CA1
Organization: "DigiCert, Inc."
Location: US
Issuer: DigiCert Global Root CA
Valid from: May 4 00:00:00 2022 GMT
Valid until: Nov 9 23:59:59 2031 GMT
Authority: CA:TRUE
Keysize: 4096 Bits
Organization: "DigiCert, Inc."
Location: US
Issuer: DigiCert Global Root CA
Valid from: May 4 00:00:00 2022 GMT
Valid until: Nov 9 23:59:59 2031 GMT
Authority: CA:TRUE
Keysize: 4096 Bits
Verify HTTP/2 Support ▼
HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency. langbird.com does not support HTTP/2
Verifying HTTP/2.0 Support. Please wait...
Http Header ▼
HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.Content-Type: text/html; charset=utf-8
Date: Thu, 01 May 2025 02:06:22 GMT
Server: Microsoft-IIS/10.0
Cache-Control: private
Location: /error/not-found
Set-Cookie: ASP.NET_SessionId=lyczangkyfu1r5fofbon1foi; path=/; HttpOnly; SameSite=Lax
Set-Cookie: ARRAffinity=cd53f96f736eabd5d6a7dfe740ec13ff67c6674edd85b2b809d91025d4fc9133;Path=/;HttpOnly;Secure;Domain=langbird.com
Set-Cookie: ARRAffinitySameSite=cd53f96f736eabd5d6a7dfe740ec13ff67c6674edd85b2b809d91025d4fc9133;Path=/;HttpOnly;SameSite=None;Secure;Domain=langbird.com
Transfer-Encoding: chunked
X-AspNetMvc-Version: 5.2
X-AspNet-Version: 4.0.30319
Request-Context: appId=cid-v1:63dd0d62-56c5-4368-9119-8b1063ad40ea
X-Powered-By: ASP.NET
HTTP/1.1 404 Not Found
Content-Length: 14620
Content-Type: text/html; charset=utf-8
Date: Thu, 01 May 2025 02:06:22 GMT
Server: Microsoft-IIS/10.0
Cache-Control: private
Set-Cookie: ARRAffinity=cd53f96f736eabd5d6a7dfe740ec13ff67c6674edd85b2b809d91025d4fc9133;Path=/;HttpOnly;Secure;Domain=langbird.com
Set-Cookie: ARRAffinitySameSite=cd53f96f736eabd5d6a7dfe740ec13ff67c6674edd85b2b809d91025d4fc9133;Path=/;HttpOnly;SameSite=None;Secure;Domain=langbird.com
X-AspNetMvc-Version: 5.2
X-AspNet-Version: 4.0.30319
Request-Context: appId=cid-v1:63dd0d62-56c5-4368-9119-8b1063ad40ea
X-Powered-By: ASP.NET
DNS Lookup ▼
DNS entries (Domain Name System) are a critical component of the Internet infrastructure. They act as directories that translate human-readable domain names (such as example.com) to machine-readable IP addresses. DNS records are stored on DNS servers and help forward internet traffic efficiently.| Type | Ip | Target/Txt | TTL |
| A | 13.74.158.5 | 3527 | |
| NS | 172727 | ||
| NS | 172727 | ||
| NS | 172727 | ||
| NS | 172727 | ||
| HINFO | 300 |
Whois Lookup ▼
Domain WHOIS is a public database that provides information about domain names, including registered owners, contact information, domain registrars, registration and expiration dates, name servers, and other relevant information. Domain registration for this website began on January 3, 2012 and will expire on January 3, 2026 if not renewed. This website is now assigned through the registrar Ascio Technologies, Inc. The WHOIS data for this website's domain was last updated on November 18, 2022.- Domain Created:
- 2012-01-03
- Domain Expires:
- 2026-01-03
- Domain Updated:
- 2022-11-18
- Domain Age:
- 13 years 10 months 11 days
- Domain Registrar:
- Ascio Technologies, Inc
- Domain Owner:
- Not Disclosed
- WhoIs:
Domain Name: langbird.com Registry Domain ID: 1695111989_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.ascio.com Registrar URL: http://www.ascio.com Updated Date: 2022-11-18T08:21:14Z Creation Date: 2012-01-03T03:02:30Z Registrar Registration Expiration Date: 2026-01-03T08:02:30Z Registrar: Ascio Technologies, Inc Registrar IANA ID: 106 Registrar Abuse Contact Email:Registrar Abuse Contact Phone: +44 (20) 81583881 Reseller: Loopia Domain Status: OK https://icann.org/epp#ok Registry Registrant ID: Not Disclosed Registrant Name: Not Disclosed Registrant Organization: Not Disclosed Registrant Street: Not Disclosed Registrant City: Not Disclosed Registrant State/Province: Registrant Postal Code: Not Disclosed Registrant Country: SE Registrant Phone: Not Disclosed Registrant Phone Ext: Not Disclosed Registrant Fax: Not Disclosed Registrant Fax Ext: Not Disclosed Registrant Email: https://whoiscontact.ascio.com?domainname=langbird.com Registry Admin ID: Not Disclosed Admin Name: Not Disclosed Admin Organization: Not Disclosed Admin Street: Not Disclosed Admin City: Not Disclosed Admin State/Province: Not Disclosed Admin Postal Code: Not Disclosed Admin Country: Not Disclosed Admin Phone: Not Disclosed Admin Phone Ext: Not Disclosed Admin Fax: Not Disclosed Admin Fax Ext: Not Disclosed Admin Email: Not Disclosed Registry Tech ID: Not Disclosed Tech Name: Not Disclosed Tech Organization: Not Disclosed Tech Street: Not Disclosed Tech City: Not Disclosed Tech State/Province: Not Disclosed Tech Postal Code: Not Disclosed Tech Country: Not Disclosed Tech Phone: Not Disclosed Tech Phone Ext: Not Disclosed Tech Fax: Not Disclosed Tech Fax Ext: Not Disclosed Tech Email: Not Disclosed Name Server: ns1-07.azure-dns.com Name Server: ns2-07.azure-dns.net Name Server: ns3-07.azure-dns.org Name Server: ns4-07.azure-dns.info DNSSEC: unsigned URL of the ICANN WHOIS Data Problem Reporting System: https://icann.org/wicf >>> Last update of WHOIS database: 2025-05-01T02:07:31Z