Filminspector.com
Domain Summary
What is the traffic rank for Filminspector.com?
• Filminspector.com ranks #1,132,177 globally on HypeStat.
What percent of global Internet users visit Filminspector.com?
• 0.00019% of global Internet users visit Filminspector.com
How many people visit Filminspector.com each day?
• Filminspector.com receives approximately 9.4K visitors and 11,896 page impressions per day.
Which countries does Filminspector.com receive most of its visitors from?
• Filminspector.com is mostly visited by people located in United States,United Kingdom,Russian Federation.
How much Filminspector.com can earn?
• Filminspector.com should earn about $47.54/day from advertising revenue.
What is Filminspector.com estimated value?
• Estimated value of Filminspector.com is $45,127.13.
What IP addresses does Filminspector.com resolve to?
• Filminspector.com resolves to the IP addresses 107.21.247.164.
Where are Filminspector.com servers located in?
• Filminspector.com has servers located in Ashburn, VA, 20149, United States.
filminspector.com Profile
What technologies does filminspector.com use?
These are the technologies used at filminspector.com. filminspector.com has a total of 10 technologies installed in 8 different categories.filminspector.com Traffic Analysis
Filminspector.com is ranked #1,132,177 in the world. This website is viewed by an estimated 9.4K visitors daily, generating a total of 11.9K pageviews. This equates to about 283.8K monthly visitors.Daily Visitors9.4K
Monthly Visits283.8K
Pages per Visit1.27
Visit duration n/a
Bounce Rate n/a
Is this your site?Verify your site's metrics.
- Daily Unique Visitors:
- 9,367
- Monthly Visits:
- 283,820
- Pages per Visit:
- 1.27
- Daily Pageviews:
- 11,896
- Avg. visit duration:
- n/a
- Bounce rate:
- n/a
- Global Reach:
- 0.00019%
- HypeRank:
- 1,132,177
Visitors by country
- Country
- Users%
- United States 36.7%
- United Kingdom 10.4%
- Russian Federation 1.5%
Where do visitors go on filminspector.com?
- Reach%Pageviews%PerUser
- worldwartwo.filminspector.com
- 44.62%49.59%1.5
- animatedfilmreviews.filminspector.com
- 12.18%9.01%1.0
- legends.filminspector.com
- 10.76%11.46%1.4
- victoriassecret.filminspector.com
- 9.18%8.30%1.2
- coloring.filminspector.com
- 5.38%3.98%1.0
Last update was 1364 days ago
This can take up to 60 seconds. Please wait...
This can take up to 60 seconds. Please wait...
*HypeStat.com is not promoting or affiliated with filminspector.com in any way. Only publicly available statistics data are displayed.
▼
SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.- Domain:
- filminspector.com
- Rank:
(Rank based on keywords, cost and organic traffic) - n/a
- Organic Keywords:
(Number of keywords in top 20 Google SERP) - 0
- Organic Traffic:
(Number of visitors coming from top 20 search results) - 0
- Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords) - $0.00
Revenue report ▼
Google.com would generate approximately $47.5 per day if the source of income were advertisements, which equates to an estimated monthly revenue of $1.4K and annual gross revenue of approximately $17.4K. Based on these figures, the site's net worth is estimated at around $45.1K.How much would filminspector.com make?
- Daily Revenue:
- $47.54
- Monthly Revenue:
- $1,426.20
- Yearly Revenue:
- $17,352.10
Daily earning by country
- CountryPageviewsEarning
- United States 3,688$17.81
- United Kingdom 1,546$4.14
- Russian Federation 357$0.15
Loss of money due to Adblock?
- Daily Revenue Loss:
- $3.88
- Monthly Revenue Loss:
- $116.34
- Yearly Revenue Loss:
- $1,415.49
- Daily Pageviews Blocked:
- 933
- Monthly Pageviews Blocked:
- 27,979
- Yearly Pageviews Blocked:
- 340,416
Daily revenue loss by country
- CountryBlockedLost Money
- United States 664$3.21
- United Kingdom 247$0.66
- Russian Federation 21$0.01
How much is filminspector.com worth?
- Website Value:
- $45.1K
Ad Experience Report ▼
Summary of the ad experience rating of a website for a specific platform.Mobile summary
- Root domain:
- filminspector.com
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Desktop summary
- Root domain:
- filminspector.com
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Abusive Experience Report ▼
Summary of the abusive experience rating of a website.- Root domain:
- filminspector.com
- Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.) - Off
- Status:
(The status of the site reviewed for the abusive experiences.) - Not reviewed
Where is filminspector.com hosted? ▼
Filminspector.com may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.- Server IP:
- 107.21.247.164
- ASN:
- AS14618
- ISP:
- Amazon.com, Inc.
- Server Location:
- Ashburn
VA
20149
United States
Other sites hosted on 107.21.247.164
How fast does filminspector.com load? ▼
The average loading time of filminspector.com is n/a ms. The Desktop speed index is 100 and mobile speed index is 100.- Average Load Time:
- n/a ms
Page Speed (Google PageSpeed Insights) - Desktop
Field Data
Over the last 30 days, the field data shows that this page has a speed compared to other pages in the Chrome User Experience Report.We are showing the 90th percentile of FCP and the 95th percentile of FID.
First Contentful Paint (FCP)0
First Input Delay (FID)0
Origin Data
All pages served from this origin have an speed compared to other pages in the Chrome User Experience Report. over the last 30 days.To view suggestions tailored to each page, analyze individual page URLs.
First Contentful Paint (FCP)0
First Input Delay (FID)0
Lab Data
Page Speed (Google PageSpeed Insights) - Mobile
Field Data
Over the last 30 days, the field data shows that this page has a speed compared to other pages in the Chrome User Experience Report.We are showing the 90th percentile of FCP and the 95th percentile of FID.
First Contentful Paint (FCP)0
First Input Delay (FID)0
Origin Data
All pages served from this origin have an speed compared to other pages in the Chrome User Experience Report. over the last 30 days.To view suggestions tailored to each page, analyze individual page URLs.
First Contentful Paint (FCP)0
First Input Delay (FID)0
Lab Data
Does filminspector.com use compression? ▼
Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on filminspector.com are reduced by %.
filminspector.com does not use compression.
Original size: n/a
Compressed size: n/a
File reduced by: (%)
Compressed size: n/a
File reduced by: (%)
Google Safe Browsing ▼
Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.SSL Checker - SSL Certificate Verify ▼
An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. filminspector.com does not support HTTPS. filminspector.com does not support HTTPS
Verifying SSL Support. Please wait...
Verify HTTP/2 Support ▼
HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency. filminspector.com does not support HTTP/2
Verifying HTTP/2.0 Support. Please wait...
Http Header ▼
HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.HTTP/1.1 200 OK
Date: Mon, 26 Dec 2016 21:01:06 GMT
Content-Type: text/html; charset=UTF-8
Connection: close
Set-Cookie: __cfduid=db47432ef8cba5393efe753fa1ef2c97c1482786064; expires=Tue, 26-Dec-17 21:01:04 GMT; path=/; domain=.filminspector.com; HttpOnly
Display: pub_site_sol
Expires: Sun, 25 Dec 2016 21:01:06 GMT
PageSpeed: off
Response: 200
Vary: Accept-Encoding,X-APP-JSON
X-Content-Type-Options: nosniff
X-Middleton-Display: pub_site_sol
X-Middleton-Response: 200
X-Sol: pub_site
X-Xss-Protection: 1; mode=block
Set-Cookie: ezouid_28099=1190367363; Path=/; Domain=filminspector.com; Expires=Sun, 16 Dec 2018 21:01:04 UTC
Set-Cookie: lp_28099=http://www.filminspector.com/; Path=/; Domain=filminspector.com; Expires=Mon, 26 Dec 2016 23:01:04 UTC
Set-Cookie: ezoadgid_28099=-1; Path=/; Domain=filminspector.com; Expires=Mon, 26 Dec 2016 21:31:04 UTC
Set-Cookie: active_template::28099=pub_site; Path=/; Domain=filminspector.com; Expires=Wed, 28 Dec 2016 21:01:04 UTC
Set-Cookie: ezoab_28099=mod6-; Path=/; Domain=filminspector.com; Expires=Mon, 26 Dec 2016 21:31:04 UTC
Set-Cookie: ezovid_28099=1448763204; Path=/; Domain=filminspector.com; Expires=Mon, 26 Dec 2016 21:31:06 UTC
Set-Cookie: ezovuuid_28099=7205f991-35dd-4a55-66a8-b5ac114482b4; Path=/; Domain=filminspector.com; Expires=Mon, 26 Dec 2016 21:31:06 UTC
Set-Cookie: ezopvc_28099=1; Path=/; Domain=filminspector.com; Expires=Tue, 27 Dec 2016 00:01:06 UTC
Last-Modified: Fri, 23 Dec 2016 21:27:34 GMT
Cache-Control: max-age=0, must-revalidate, no-cache, no-store
Server: cloudflare-nginx
CF-RAY: 3177774843d82507-ORD
DNS Lookup ▼
DNS entries (Domain Name System) are a critical component of the Internet infrastructure. They act as directories that translate human-readable domain names (such as example.com) to machine-readable IP addresses. DNS records are stored on DNS servers and help forward internet traffic efficiently.Type | Ip | Target/Txt | TTL |
SOA | 900 | ||
Mname | wasp.ezoicns.com | ||
Rname | awsdns-hostmaster.amazon.com | ||
Serial Number | 1 | ||
Refresh | 7200 | ||
Retry | 900 | ||
Expire | 1209600 | ||
Minimum TTL | 86400 | ||
A | 107.22.169.109 | 60 | |
NS | 3592 | ||
NS | 3592 | ||
NS | 3592 | ||
NS | 3592 |
Whois Lookup ▼
Domain WHOIS is a public database that provides information about domain names, including registered owners, contact information, domain registrars, registration and expiration dates, name servers, and other relevant information. Domain registration for this website began on October 8, 2013 and will expire on April 25, 2024 if not renewed. This website is now assigned through the registrar . The WHOIS data for this website's domain was last updated on April 25, 2024.- Domain Created:
- 2013-10-08
- Domain Age:
- 10 years 6 months 17 days
- WhoIs:
whois lookup at whois.enom.com...Domain Name: FILMINSPECTOR.COM Registry Domain ID: 1830291593_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.enom.com Registrar URL: www.enom.com Updated Date: 2014-09-23T06:06:04.00Z Creation Date: 2013-10-08T02:20:00.00Z Registrar Registration Expiration Date: 2019-10-08T02:20:28.00Z Registrar: ENOM, INC. Registrar IANA ID: 48 Reseller: NAMECHEAP.COM Domain Status: ok https://www.icann.org/epp#ok Registry Registrant ID: Registrant Name: JAMES BJORKMAN Registrant Organization: FILM INSPECTOR Registrant Street: 8170 ESSINGTON DRIVE Registrant City: COLORADO SPRINGS Registrant State/Province: CO Registrant Postal Code: 80920 Registrant Country: US Registrant Phone: +1.7192335460 Registrant Phone Ext: Registrant Fax: +1.5555555555 Registrant Fax Ext: Registrant Email: Registry Admin ID: Admin Name: JAMES BJORKMAN Admin Organization: FILM INSPECTOR Admin Street: 8170 ESSINGTON DRIVE Admin City: COLORADO SPRINGS Admin State/Province: CO Admin Postal Code: 80920 Admin Country: US Admin Phone: +1.7192335460 Admin Phone Ext: Admin Fax: +1.5555555555 Admin Fax Ext: Admin Email: Registry Tech ID: Tech Name: JAMES BJORKMAN Tech Organization: FILM INSPECTOR Tech Street: 8170 ESSINGTON DRIVE Tech City: COLORADO SPRINGS Tech State/Province: CO Tech Postal Code: 80920 Tech Country: US Tech Phone: +1.7192335460 Tech Phone Ext: Tech Fax: +1.5555555555 Tech Fax Ext: Tech Email: Name Server: BARB.EZOICNS.COM Name Server: KUDU.EZOICNS.COM DNSSEC: unSigned Registrar Abuse Contact Email: Registrar Abuse Contact Phone: +1.4252982646 URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/ >>> Last update of WHOIS database: 2014-09-23T06:06:04.00Z <<< For more information on Whois status codes, please visit https://icann.org/epp The data in this whois database is provided to you for information purposes only, that is, to assist you in obtaining information about or related to a domain name registration record. We make this information available "as is," and do not guarantee its accuracy. By submitting a whois query, you agree that you will use this data only for lawful purposes and that, under no circumstances will you use this data to: (1) enable high volume, automated, electronic processes that stress or load this whois database system providing you this information; or (2) allow, enable, or otherwise support the transmission of mass unsolicited, commercial advertising or solicitations via direct mail, electronic mail, or by telephone. The compilation, repackaging, dissemination or other use of this data is expressly prohibited without prior written consent from us. We reserve the right to modify these terms at any time. By submitting this query, you agree to abide by these terms. Version 6.3 4/3/2002whois lookup at whois.crsnic.net...Whois Server Version 2.0 Domain names in the .com and .net domains can now be registered with many different competing registrars. Go to http://www.internic.net for detailed information. Domain Name: FILMINSPECTOR.COM Registrar: ENOM, INC. Sponsoring Registrar IANA ID: 48 Whois Server: whois.enom.com Referral URL: http://www.enom.com Name Server: BARB.EZOICNS.COM Name Server: KUDU.EZOICNS.COM Status: ok https://icann.org/epp#ok Updated Date: 05-oct-2016 Creation Date: 08-oct-2013 Expiration Date: 08-oct-2019 >>> Last update of whois database: Mon, 26 Dec 2016 21:00:53 GMT <<< For more information on Whois status codes, please visit https://icann.org/epp NOTICE: The expiration date displayed in this record is the date the registrar's sponsorship of the domain name registration in the registry is currently set to expire. This date does not necessarily reflect the expiration date of the domain name registrant's agreement with the sponsoring registrar. Users may consult the sponsoring registrar's Whois database to view the registrar's reported date of expiration for this registration. TERMS OF USE: You are not authorized to access or query our Whois database through the use of electronic processes that are high-volume and automated except as reasonably necessary to register domain names or modify existing registrations; the Data in VeriSign Global Registry Services' ("VeriSign") Whois database is provided by VeriSign for information purposes only, and to assist persons in obtaining information about or related to a domain name registration record. VeriSign does not guarantee its accuracy. By submitting a Whois query, you agree to abide by the following terms of use: You agree that you may use this Data only for lawful purposes and that under no circumstances will you use this Data to: (1) allow, enable, or otherwise support the transmission of mass unsolicited, commercial advertising or solicitations via e-mail, telephone, or facsimile; or (2) enable high volume, automated, electronic processes that apply to VeriSign (or its computer systems). The compilation, repackaging, dissemination or other use of this Data is expressly prohibited without the prior written consent of VeriSign. You agree not to use electronic processes that are automated and high-volume to access or query the Whois database except as reasonably necessary to register domain names or modify existing registrations. VeriSign reserves the right to restrict your access to the Whois database in its sole discretion to ensure operational stability. VeriSign may restrict or terminate your access to the Whois database for failure to abide by these terms of use. VeriSign reserves the right to modify these terms at any time. The Registry database contains ONLY .COM, .NET, .EDU domains and Registrars.