Capitalmarketsinfrastructure.com
Capital Markets InfrastructureDomain Summary
What is the traffic rank for Capitalmarketsinfrastructure.com?
• Capitalmarketsinfrastructure.com ranks #11,525,839 globally on HypeStat.
What IP addresses does Capitalmarketsinfrastructure.com resolve to?
• Capitalmarketsinfrastructure.com resolves to the IP addresses 2001:67c:38c::65, 195.149.84.101.
Where are Capitalmarketsinfrastructure.com servers located in?
• Capitalmarketsinfrastructure.com has servers located in United Kingdom.
capitalmarketsinfrastructure.com Profile
Title:Capital Markets Infrastructure
Description:Integration of market infrastructure
“Integration of market infrastructure in Europe?†See in three minutes how the European market infrastructure for payment a
Tags:
What technologies does capitalmarketsinfrastructure.com use?
These are the technologies used at capitalmarketsinfrastructure.com. capitalmarketsinfrastructure.com has a total of 5 technologies installed in 5 different categories.capitalmarketsinfrastructure.com Traffic Analysis
Capitalmarketsinfrastructure.com is ranked #11,525,839 in the world.Daily Visitors n/a
Monthly Visits n/a
Pages per Visit n/a
Visit duration n/a
Bounce Rate n/a
Is this your site?Verify your site's metrics.
- Daily Unique Visitors:
- n/a
- Monthly Visits:
- n/a
- Pages per Visit:
- n/a
- Daily Pageviews:
- n/a
- Avg. visit duration:
- n/a
- Bounce rate:
- n/a
- Global Reach:
- n/a
- HypeRank:
- 11,525,839
Last update was 1830 days ago
This can take up to 60 seconds. Please wait...
This can take up to 60 seconds. Please wait...
*HypeStat.com is not promoting or affiliated with capitalmarketsinfrastructure.com in any way. Only publicly available statistics data are displayed.
▼
SEMrush is a complete on line advertising and marketing platform that gives a extensive variety of gear and functions to help companies and entrepreneurs in enhancing their on line visibility and optimizing their virtual advertising and marketing strategies.- Domain:
- capitalmarketsinfrastructure.com
- Rank:
(Rank based on keywords, cost and organic traffic) - n/a
- Organic Keywords:
(Number of keywords in top 20 Google SERP) - 0
- Organic Traffic:
(Number of visitors coming from top 20 search results) - 0
- Organic Cost:
((How much need to spend if get same number of visitors from Google Adwords) - $0.00
Ad Experience Report ▼
Summary of the ad experience rating of a website for a specific platform.Mobile summary
- Root domain:
- capitalmarketsinfrastructure.com
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Desktop summary
- Root domain:
- capitalmarketsinfrastructure.com
- Ad filtering:
(Chrome is not filtering ads on your site.) - Off
- Status:
(The status of the site that is reviewed for the Better Ads Standards.) - Not reviewed
Abusive Experience Report ▼
Summary of the abusive experience rating of a website.- Root domain:
- capitalmarketsinfrastructure.com
- Enforcement:
(Chrome is not preventing your site from opening new windows or tabs.) - Off
- Status:
(The status of the site reviewed for the abusive experiences.) - Not reviewed
Where is capitalmarketsinfrastructure.com hosted? ▼
Capitalmarketsinfrastructure.com may be hosted in multiple data centers distributed in different locations around the world. This is probably just one of them.- Server IP:
- 2001:67c:38c::65, 195.149.84.101
- ASN:
- AS43081
- ISP:
- World News PTE. LTD
- Server Location:
United Kingdom, GB
Other sites hosted on 195.149.84.101
Does capitalmarketsinfrastructure.com use compression? ▼
Website compression is the process of reducing the size of website files, such as HTML, CSS, JavaScript, and image files, to improve website performance and load times. Compressing website files can significantly reduce the amount of data that needs to be transferred from the server to the user's browser, resulting in faster page load times and improved user experience. Files on capitalmarketsinfrastructure.com are reduced by 77%.
capitalmarketsinfrastructure.com use gzip compression.
Original size: 155.17 KB
Compressed size: 34.63 KB
File reduced by: 120.54 KB (77%)
Compressed size: 34.63 KB
File reduced by: 120.54 KB (77%)
Google Safe Browsing ▼
Google Safe Browsing is a service provided by Google that helps protect users from visiting websites that may contain malicious or harmful content, such as malware, phishing attempts, or deceptive software.SSL Checker - SSL Certificate Verify ▼
An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's web browser. It provides authentication and encryption, ensuring that data transmitted between the server and the browser remains private and protected. capitalmarketsinfrastructure.com supports HTTPS. capitalmarketsinfrastructure.com supports HTTPS
Verifying SSL Support. Please wait...
Verify HTTP/2 Support ▼
HTTP/2 (Hypertext Transfer Protocol version 2) is a major revision of the HTTP protocol, which is the foundation of data communication on the World Wide Web. It was developed as an improvement over the previous HTTP/1.1 version to enhance web performance and efficiency. capitalmarketsinfrastructure.com supports HTTP/2
Verifying HTTP/2.0 Support. Please wait...
Http Header ▼
HTTP headers are extra portions of records despatched among a consumer (which include an internet browser) and a server at some stage in an HTTP request or response. They offer instructions, metadata, or manipulate parameters for the conversation among the consumer and server.Date: Mon, 22 Apr 2019 18:35:35 GMT
Server: Apache
X-Powered-By: PHP/7.3.4
X-Pingback: http://smockhub.com/xmlrpc.php
Link: <http://smockhub.com/wp-json/>; rel="https://api.w.org/", <http://smockhub.com/>; rel=shortlink
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 20320
Content-Type: text/html; charset=UTF-8
Date: Mon, 22 Apr 2019 18:35:45 GMT
Content-Type: text/html; charset=iso-8859-1
Content-Length: 241
Connection: keep-alive
Keep-Alive: timeout=30
Server: Apache/2
X-Powered-By: PHP/5.3.29
X-Redirect-By: WordPress
Location: http://www.vanessaterrell.design/
Accept-Ranges: bytes
Age: 0
HTTP/1.1 200 OK
Date: Mon, 22 Apr 2019 18:35:46 GMT
Content-Type: text/html; charset=UTF-8
Content-Length: 33523
Connection: keep-alive
Keep-Alive: timeout=30
Server: Apache/2
X-Powered-By: PHP/5.3.29
Link: <http://www.vanessaterrell.design/wp-json/>; rel="https://api.w.org/"
Link: <http://www.vanessaterrell.design/>; rel=shortlink
Accept-Ranges: bytes
Age: 0
date: Mon, 22 Apr 2019 17:24:00 GMT
x-servedby: web028
location: https://www.featherbeings.com/
server: envoy
Age: 4309
X-Varnish: varnish-web002
Set-Cookie: crumb=Beng4IYb/xsqNTA2NDQxZTNhNWQyODM1YzFhY2NiMDU2YmU3Yzkx;Path=/
Content-Length: 0
x-contextid: gGKtn2Gn/G3WysssH
x-via: 1.1 echo008
HTTP/2 200
date: Mon, 22 Apr 2019 18:00:31 GMT
x-servedby: web081
strict-transport-security: max-age=0
expires: Thu, 01 Jan 1970 00:00:00 GMT
content-type: text/html; charset=UTF-8
x-pc-appver: 17672
x-pc-date: Mon, 22 Apr 2019 03:59:52 GMT
x-pc-host: 10.122.7.21
last-modified: Mon, 22 Apr 2019 17:36:11 GMT
content-encoding: gzip
etag: W/"5e56a5128854885debf75bb50638bd94"
x-pc-key: ZdzEpk-v8dzY-ggH1N15KXIETds-olivier-plante
x-pc-hit: true
content-length: 26807
server: envoy
vary: Accept-Encoding
age: 2118
x-varnish: varnish-web008
set-cookie: crumb=Bei20PErROeYZDBhOTM2ZGI0Yjk4NWQxM2MyZjdjZTJmYjYzYmQ5;Path=/
accept-ranges: bytes
x-contextid: CAL34m7y/7k3B47fl
x-via: 1.1 echo033
Content-Type: text/html
Content-Encoding: gzip
Last-Modified: Wed, 13 Mar 2019 13:22:01 GMT
Accept-Ranges: bytes
ETag: "b4296abe9fd9d41:0"
Vary: Accept-Encoding
Server: Microsoft-IIS/10.0
X-Powered-By: ASP.NET
X-Powered-By-Plesk: PleskWin
Date: Mon, 22 Apr 2019 18:35:47 GMT
Content-Length: 542
Server: openresty
Date: Mon, 22 Apr 2019 18:35:56 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
X-Powered-By: PHP/7.2.13
Link: <http://bestwigs.site/wp-json/>; rel="https://api.w.org/"
Content-Encoding: gzip
Location: http://www.justbeingchlo.com/
Date: Mon, 22 Apr 2019 18:35:58 GMT
Content-Type: text/html; charset=UTF-8
Server: ghs
Content-Length: 226
X-XSS-Protection: 0
X-Frame-Options: SAMEORIGIN
HTTP/1.1 301 Moved Permanently
Location: https://www.justbeingchlo.com/
Content-Type: text/html; charset=UTF-8
Content-Encoding: gzip
Date: Mon, 22 Apr 2019 18:35:58 GMT
Expires: Mon, 22 Apr 2019 18:35:58 GMT
Cache-Control: private, max-age=0
X-Content-Type-Options: nosniff
X-Frame-Options: SAMEORIGIN
X-XSS-Protection: 1; mode=block
Content-Length: 178
Server: GSE
HTTP/2 200
content-type: text/html; charset=UTF-8
expires: Mon, 22 Apr 2019 18:35:59 GMT
date: Mon, 22 Apr 2019 18:35:59 GMT
cache-control: private, max-age=0
last-modified: Sun, 21 Apr 2019 07:00:08 GMT
etag: W/"1edea9b1f503d9e71da7fc42cae52c15b1a43ab42f0bf7639f31036daefe3fa0"
content-encoding: gzip
x-content-type-options: nosniff
x-xss-protection: 1; mode=block
content-length: 65006
server: GSE
Server: nginx
Date: Mon, 22 Apr 2019 18:37:00 GMT
Content-Type: text/html; charset=UTF-8
Content-Length: 0
Connection: keep-alive
X-Redirect-By: WordPress
Location: https://taberuiimono.com/
HTTP/2 200
server: nginx
date: Mon, 22 Apr 2019 18:37:01 GMT
content-type: text/html; charset=UTF-8
vary: Accept-Encoding
link: <https://taberuiimono.com/wp-json/>; rel="https://api.w.org/"
content-encoding: gzip
Content-Type: text/html; charset=UTF-8
Link: <https://windows-pvc.com/?rest_route=/>; rel="https://api.w.org/"
Vary: Accept-Encoding
X-LS-Pagespeed: 2.1-1.11.33.4
Transfer-Encoding: chunked
Content-Encoding: br
Date: Mon, 22 Apr 2019 18:37:03 GMT
Server: LiteSpeed
Connection: Keep-Alive
Server: nginx
Date: Mon, 22 Apr 2019 18:37:05 GMT
Content-Type: text/html
Content-Length: 178
Connection: keep-alive
Location: https://capitalmarketsinfrastructure.com/
HTTP/2 200
server: nginx
date: Mon, 22 Apr 2019 18:37:11 GMT
content-type: text/html; charset=utf-8
vary: Accept-Encoding
set-cookie: wnTrk=wn.1555958226.478984.wnstatic1.24598.6445; Domain=.capitalmarketsinfrastructure.com; expires=Wed, 23 Apr 2087 07:11:06 GMT
vary: User-Agent
strict-transport-security: max-age=15768000
cache-control: must-revalidate
content-encoding: gzip
DNS Lookup ▼
DNS entries (Domain Name System) are a critical component of the Internet infrastructure. They act as directories that translate human-readable domain names (such as example.com) to machine-readable IP addresses. DNS records are stored on DNS servers and help forward internet traffic efficiently.Type | Ip | Target/Txt | TTL |
TXT | 900 | ||
AAAA | 2001:67c:38c::64 | 900 | |
AAAA | 2001:67c:38c::65 | 900 | |
SOA | 900 | ||
Mname | redbusprimarydns.capitalmarketsinfrastructure.com | ||
Rname | root.wn.com | ||
Serial Number | 202620261 | ||
Refresh | 7200 | ||
Retry | 900 | ||
Expire | 604800 | ||
Minimum TTL | 900 | ||
A | 195.149.84.100 | 900 | |
NS | 900 | ||
NS | 900 |